Product: PPAR alpha Antibody
Catalog: AF5301
Description: Rabbit polyclonal antibody to PPAR alpha
Application: WB IHC IF/ICC
Cited expt.: WB, IHC, IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Bovine, Horse, Sheep, Rabbit, Dog, Xenopus
Mol.Wt.: 45-55kDa(Observed); 52kD(Calculated).
Uniprot: Q07869
RRID: AB_2837786

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Bovine(100%), Horse(88%), Sheep(100%), Rabbit(100%), Dog(100%), Xenopus(100%)
Clonality:
Polyclonal
Specificity:
PPAR alpha Antibody detects endogenous levels of total PPAR alpha.
RRID:
AB_2837786
Cite Format: Affinity Biosciences Cat# AF5301, RRID:AB_2837786.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

hPPAR; MGC2237; MGC2452; NR1C1; Nuclear receptor subfamily 1 group C member 1; OTTHUMP00000197740; OTTHUMP00000197741; Peroxisome proliferative activated receptor alpha; Peroxisome proliferator activated receptor alpha; Peroxisome proliferator-activated receptor alpha; PPAR; PPAR-alpha; ppara; PPARA_HUMAN; PPARalpha;

Immunogens

Immunogen:

A synthesized peptide derived from human PPAR alpha, corresponding to a region within N-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
Q07869 PPARA_HUMAN:

Skeletal muscle, liver, heart and kidney. Expressed in monocytes (PubMed:28167758).

Description:
Ligand-activated transcription factor. Key regulator of lipid metabolism. Activated by the endogenous ligand 1-palmitoyl-2-oleoyl-sn-glycerol-3-phosphocholine (16:0/18:1-GPC). Activated by oleylethanolamide, a naturally occurring lipid that regulates satiety (By similarity). Receptor for peroxisome proliferators such as hypolipidemic drugs and fatty acids. Regulates the peroxisomal beta-oxidation pathway of fatty acids.
Sequence:
MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Bovine
100
Sheep
100
Dog
100
Xenopus
100
Rabbit
100
Horse
88
Pig
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Ligand-activated transcription factor. Key regulator of lipid metabolism. Activated by the endogenous ligand 1-palmitoyl-2-oleoyl-sn-glycerol-3-phosphocholine (16:0/18:1-GPC). Activated by oleylethanolamide, a naturally occurring lipid that regulates satiety. Receptor for peroxisome proliferators such as hypolipidemic drugs and fatty acids. Regulates the peroxisomal beta-oxidation pathway of fatty acids. Functions as transcription activator for the ACOX1 and P450 genes. Transactivation activity requires heterodimerization with RXRA and is antagonized by NR2C2. May be required for the propagation of clock information to metabolic pathways regulated by PER2.

Subcellular Location:

Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Skeletal muscle, liver, heart and kidney. Expressed in monocytes.

Family&Domains:

Belongs to the nuclear hormone receptor family. NR1 subfamily.

Research Fields

· Environmental Information Processing > Signal transduction > cAMP signaling pathway.   (View pathway)

· Human Diseases > Endocrine and metabolic diseases > Insulin resistance.

· Human Diseases > Endocrine and metabolic diseases > Non-alcoholic fatty liver disease (NAFLD).

· Human Diseases > Infectious diseases: Viral > Hepatitis C.

· Organismal Systems > Endocrine system > PPAR signaling pathway.

· Organismal Systems > Endocrine system > Adipocytokine signaling pathway.

· Organismal Systems > Endocrine system > Glucagon signaling pathway.

References

1). Rescuing SERCA2 pump deficiency improves bone mechano-responsiveness in type 2 diabetes by shaping osteocyte calcium dynamics. Nature communications, 2024 (PubMed: 38291059) [IF=16.6]

Application: WB    Species: Mouse    Sample:

Fig. 9 The nuclear transcription factor PPARα mediates T2D-induced specific reduction in the expression of osteocytic SERCA2 pump. a RNA-seq-based KEGG pathway analysis showing the top 10 enriched KEGG pathways. b, c GSEA analysis showing a significant enrichment of signaling events associated with PPARα and PPARDR1_Q2. d The PPARα and p-PPARα protein expression in osteocytes. e Immunohistochemical staining of osteocytic PPARα in diabetic and non-diabetic tibiae. f The SERCA2 expression in osteocytes treated with antagonists of PPARα (MK886 and GW6471), PPARβ/δ (GSK0660 and GSK3787), and PPARγ (T0070907 and GW9662). g The SERCA2 expression in HGHF-exposed osteocytes treated with agonists of PPARα (Fenofibrate and GW7647), PPARβ/δ (GW0742 and GW501516), and PPARγ (rosiglitazone and pioglitazone). h A schematic representation and the relative luciferase activities of three ATP2A2 promotor regions. i The relative luciferase activity assays of Seg#1, Seg#2 and Seg#3. j The relative luciferase activity in HGHF-treated osteocytes with PPARα silencing. k ChIP assays showing the PPARα enrichment on ATP2A2 promotor in normal and HGHF-treated osteocytes. l EMSA assays confirming the binding of PPARα to the ATP2A2 promoter region (−620 to −608 bp). The nuclear extract were incubated with biotin-labeled wild-type (WT-biotin) probe, unlabeled wild-type (WT) probe, and biotin-labeled mutated (Mut-biotin) probe. Red letters indicate substituted nucleotide sequences in the mutated probes (P1: −620 to −608 bp; P2: −1283 to −1277 bp). m, n Intracellular Ca2+ signaling and protein expression of osteocyte-related cytokines in HGHF-treated osteocytes with PPARα overexpression subjected to FSS. o, p Intracellular Ca2+ signaling and the expression of osteocyte-related cytokines in MLO-Y4 cells with lentiviral silencing of PPARα subjected to FSS. Graphs represent mean ± SD (d, f, g, i–k, m, o n = 6 biologically independent replicates; e n = 8 mice per group; l n = 3 independent replicates; n, p: n = 120 cells per group). a P value was obtained by one-tailed hypergeometric test. b, c P values were obtained by one-tailed permutation test. d–h, n, p ***P 

2). Melatonin receptor 1a alleviates sleep fragmentation-aggravated testicular injury in T2DM by suppression of TAB1/TAK1 complex through FGFR1. Acta pharmaceutica Sinica. B, 2025 (PubMed: 40698135) [IF=14.7]

Application: WB    Species: Mouse    Sample:

Figure 2. SF exacerbated lipid metabolism disorders in mice. (A) KO annotation for the DEGs in testis between DM-SF vs. DM mice. (B) Effect of SF on characteristic genes indicative of lipid homeostasis and fatty acid metabolism pathway shown by GSEA analysis. (C) KEGG pathway enrichment analysis of DEGs in CSR rat (GSE141699). (D) GSEA analysis showed that CSR was negatively associated with fatty acid metabolism and fatty acid degradation. (E) KEGG pathway enrichment analysis of DEGs in timed sleep restriction mice (GSE38921). (F) A chordal graph of enriched KEGG terms showed the relationship between DEGs and KEGG pathways related to lipid metabolism. (G) TG and T-CHO content in serum and testis homogenates (n = 6). (H) SREBP1 and PPARA protein levels in the testis and densitometric quantification (n = 6). (I) Relative mRNA levels of Srebp1, Acaca, Fasn, Ppara, Acox1, Acadm, and Cpt1a in the testis (n = 6). Data shown in graphs represent the means ± SD; GAPDH was used as an internal control; ∗P < 0.05; NS, not significant.

3). USP25 directly interacts with and deubiquitinates PPARα to increase PPARα stability in hepatocytes and attenuate high-fat diet-induced MASLD in mice. Cell death and differentiation, 2025 (PubMed: 39827322) [IF=13.7]

4). Regulatory effects mediated by ulvan oligosaccharide and its zinc complex on lipid metabolism in high-fat diet-fed mice. Carbohydrate Polymers, 2023 (PubMed: 36372481) [IF=10.7]

5). USP7 promotes cardiometabolic disorders and mitochondrial homeostasis dysfunction in diabetic mice via stabilizing PGC1β. Pharmacological research, 2024 (PubMed: 38815879) [IF=9.1]

Application: WB    Species: Mouse    Sample: heart

Fig. 5. USP7 inhibition mitigated PGC1β/PPARα related cardiometabolic signaling pathway in the hearts of diabetic mice and NMCMs treated with HG+PA or H9c2 cells treated with PA. (A) Representative Western blot and quantification of PGC1β, PPARα, CD36 and CPT1 expression in the heart of a diabetic mouse treated with P5091. n = 5 in each group. *P

6). Pu-erh tea increases the metabolite Cinnabarinic acid to improve circadian rhythm disorder-induced obesity. Food Chemistry, 2022 (PubMed: 35749873) [IF=8.5]

7). Caveolin-1 mitigates the advancement of metabolic dysfunction-associated steatotic liver disease by reducing endoplasmic reticulum stress and pyroptosis through the restoration of cholesterol homeostasis. International journal of biological sciences, 2025 (PubMed: 39781461) [IF=8.2]

8). Flavonoids from Rhododendron nivale Hook. f ameliorate alcohol-associated liver disease via activating the PPARα signaling pathway. Phytomedicine : international journal of phytotherapy and phytopharmacology, 2024 (PubMed: 39556985) [IF=7.9]

9). Enhancing polysaccharide release rate from sea cucumber powder by ultrafine milling: Improving ability to interfere with atherosclerosis. International journal of biological macromolecules, 2025 (PubMed: 40840750) [IF=7.7]

10). Sepia pharaonis ink derived melanin ameliorated high-fat diet induced lipid dysmetabolism: Insights from microbiome and hepatic transcription. Food research international (Ottawa, Ont.), 2026 (PubMed: 41539751) [IF=7.0]

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.