Product: CDKN2A/p16INK4a Antibody
Catalog: AF5484
Description: Rabbit polyclonal antibody to CDKN2A/p16INK4a
Application: WB IF/ICC
Cited expt.: WB
Reactivity: Human, Mouse
Prediction: Pig, Bovine, Horse, Rabbit
Mol.Wt.: 16 kDa; 17kD(Calculated).
Uniprot: P42771
RRID: AB_2837964

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Prediction:
Pig(85%), Bovine(82%), Horse(85%), Rabbit(100%)
Clonality:
Polyclonal
Specificity:
CDKN2A/p16INK4a Antibody detects endogenous levels of total CDKN2A/p16INK4a.
RRID:
AB_2837964
Cite Format: Affinity Biosciences Cat# AF5484, RRID:AB_2837964.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Cyclin-dependent kinase inhibitor 2A;Cyclin-dependent kinase 4 inhibitor A;CDK4I;Multiple tumor suppressor 1;MTS-1;p16-INK4a;p16-INK4;p16INK4A;CDKN2A;CDKN2;MTS1;

Immunogens

Immunogen:

A synthesized peptide derived from human CDKN2A/p16INK4a, corresponding to a region within N-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
P42771 CDN2A_HUMAN:

Widely expressed but not detected in brain or skeletal muscle. Isoform 3 is pancreas-specific.

Description:
Acts as a negative regulator of the proliferation of normal cells by interacting strongly with CDK4 and CDK6. This inhibits their ability to interact with cyclins D and to phosphorylate the retinoblastoma protein.
Sequence:
MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Rabbit
100
Pig
85
Horse
85
Bovine
82
Sheep
0
Dog
0
Xenopus
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Acts as a negative regulator of the proliferation of normal cells by interacting strongly with CDK4 and CDK6. This inhibits their ability to interact with cyclins D and to phosphorylate the retinoblastoma protein.

PTMs:

Phosphorylation seems to increase interaction with CDK4.

Subcellular Location:

Cytoplasm. Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Widely expressed but not detected in brain or skeletal muscle. Isoform 3 is pancreas-specific.

Family&Domains:

Belongs to the CDKN2 cyclin-dependent kinase inhibitor family.

Research Fields

· Cellular Processes > Cell growth and death > Cell cycle.   (View pathway)

· Cellular Processes > Cell growth and death > p53 signaling pathway.   (View pathway)

· Cellular Processes > Cell growth and death > Cellular senescence.   (View pathway)

· Human Diseases > Drug resistance: Antineoplastic > Endocrine resistance.

· Human Diseases > Drug resistance: Antineoplastic > Platinum drug resistance.

· Human Diseases > Infectious diseases: Viral > HTLV-I infection.

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Overview > Viral carcinogenesis.

· Human Diseases > Cancers: Overview > MicroRNAs in cancer.

· Human Diseases > Cancers: Specific types > Pancreatic cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Glioma.   (View pathway)

· Human Diseases > Cancers: Specific types > Melanoma.   (View pathway)

· Human Diseases > Cancers: Specific types > Bladder cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Chronic myeloid leukemia.   (View pathway)

· Human Diseases > Cancers: Specific types > Non-small cell lung cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Hepatocellular carcinoma.   (View pathway)

References

1). Sirt3-mediated mitophagy regulates AGEs-induced BMSCs senescence and senile osteoporosis. Redox Biology, 2021 (PubMed: 33662874) [IF=10.7]

Application: WB    Species: mice    Sample: bone marrow mesenchymal stem (BMSCs)

Fig. 1. Effects of AGEs in different concentrations on the senescence of BMSCs. The BMSCs were treated with AGEs (50–200 μg/mL) or BSA for 24–72 h. (A) SA-β-gal assay for detection of BMSCs senescence. Scale bar: 100 μm. (B) Detection of H3K9me3 by immunofluorescence in BMSCs. Scale bar: 100 μm. (C) Detection of γ-H2AX by immunofluorescence in BMSCs. Scale bar: 100 μm. (D–I) Representative Western blotting assay and quantitation of the level of P16, P21, P53. **p < 0.01 versus BSA.

2). Heme oxygenase-1 prevents heart against myocardial infarction by attenuating ischemic injury-induced cardiomyocytes senescence. EBioMedicine, 2019 (PubMed: 30527623) [IF=9.7]

3). VDR activation attenuates osteoblastic ferroptosis and senescence by stimulating the Nrf2/GPX4 pathway in age-related osteoporosis. Free Radical Biology and Medicine, 2022 (PubMed: 36402439) [IF=7.1]

4). Oxygen–Glucose Deprivation Promoted Fibroblast Senescence and Collagen Expression via IL11. International Journal of Molecular Sciences, 2022 (PubMed: 36292942) [IF=5.6]

5). Mechanistic study of the regulation of mitochondrial function by the GPNMB/Nrf2/NF-κB signaling pathway mediated by Quzhi Tang to alleviate chondrocyte senescence. Journal of ethnopharmacology, 2024 (PubMed: 39617085) [IF=5.4]

6). Injectable Hydrogel-Encapsulating Pickering Emulsion for Overcoming Lenvatinib-Resistant Hepatocellular Carcinoma via Cuproptosis Induction and Stemness Inhibition. Polymers, 2024 [IF=5.0]

Application: WB    Species: Human    Sample: HCC cell

Figure 3. DSF@CuO induced the upregulation of ROS, LPO, and severe mitochondria damage, resulting in cuproptosis. (A) The impact of different treatment groups on copper ion transport. (B,C) FCM was used to analyze the expression of JC-1 in different treatment groups. (D,E) Flow cytometry was used to analyze the expression of LPO in different treatment groups. (F) Fluorescence microscopy is used to detect changes in ROS and JC-1 probe levels in different treatment groups. (G,H) WB was used to verify the protein expression of cuproptosis across different treatment groups. (I) Representative Bio-TEM images of WT-Huh7 cells and LenR HCC cells before and after treatment with DSF@CuO. (G1: corn oil, G2: DSF, G3: CuO NPs, G4: Len@CuO, and G5: DSF@CuO). Data are presented as mean ± SD and are representative of three independent experiments. ** p < 0.01, *** p < 0.001.

7). The downregulation of miR-509-3p expression by collagen type XI alpha 1-regulated hypermethylation facilitates cancer progression and chemoresistance via the DNA methyltransferase 1/Small ubiquitin-like modifier-3 axis in ovarian cancer cells. Journal of ovarian research, 2023 (PubMed: 37386587) [IF=4.0]

Application: WB    Species: Human    Sample: OVCAR-3 cells

Fig. 4 Downregulation of miR-509-3p transcription by COL11A1 increases DNMT1 stability. A The mRNA expression levels of COL11A1 and miR-509-3p in A2780CP70 and OVCAR-8 cells transfected with miR-509-3p mimics and in A2780 and OVCAR-3 cells transfected with the miR-509-3p inhibitor were evaluated using real-time RT-PCR. All experiments were performed in triplicate. B Upper panel: mRNA expression levels of miR-509-3p and COL11A1 in A2780CP70 and OVCAR-8 cells transfected with COL11A1 shRNA were evaluated using real-time RT-PCR. All experiments were performed in triplicate. * P 

8). An EMT-related genes signature as a prognostic biomarker for patients with endometrial cancer. BMC Cancer, 2023 (PubMed: 37723477) [IF=3.8]

9). Resveratrol promotes oxidative stress to drive DLC1 mediated cellular senescence in cancer cells. EXPERIMENTAL CELL RESEARCH, 2018 (PubMed: 29964052) [IF=3.3]

10). Targeting Cartilage miR-195/497 Cluster for Osteoarthritis Treatment Regulates the Circadian Clock. Gerontology, 2024 (PubMed: 37827130) [IF=3.1]

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.