CDKN2A/p16INK4a Antibody - #AF5484

(24)   (7)  
Product: CDKN2A/p16INK4a Antibody
Catalog: AF5484
Description: Rabbit polyclonal antibody to CDKN2A/p16INK4a
Application: WB IF/ICC
Cited expt.: WB, IF/ICC
Reactivity: Human, Mouse
Prediction: Pig, Bovine, Horse, Rabbit
Mol.Wt.: 16 kDa; 17kD(Calculated).
Uniprot: P42771
RRID: AB_2837964

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Prediction:
Pig(85%), Bovine(82%), Horse(85%), Rabbit(100%)
Clonality:
Polyclonal
Specificity:
CDKN2A/p16INK4a Antibody detects endogenous levels of total CDKN2A/p16INK4a.
RRID:
AB_2837964
Cite Format: Affinity Biosciences Cat# AF5484, RRID:AB_2837964.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Cyclin-dependent kinase inhibitor 2A;Cyclin-dependent kinase 4 inhibitor A;CDK4I;Multiple tumor suppressor 1;MTS-1;p16-INK4a;p16-INK4;p16INK4A;CDKN2A;CDKN2;MTS1;

Immunogens

Immunogen:

A synthesized peptide derived from human CDKN2A/p16INK4a, corresponding to a region within N-terminal amino acids.

Uniprot:

P42771(CDN2A_HUMAN) >>Visit HPA database.

Gene(ID):
CDKN2A(1029)
Expression:
P42771 CDN2A_HUMAN:

Widely expressed but not detected in brain or skeletal muscle. Isoform 3 is pancreas-specific.

Description:
Acts as a negative regulator of the proliferation of normal cells by interacting strongly with CDK4 and CDK6. This inhibits their ability to interact with cyclins D and to phosphorylate the retinoblastoma protein.
Sequence:
MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Rabbit
100
Pig
85
Horse
85
Bovine
82
Sheep
0
Dog
0
Xenopus
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Acts as a negative regulator of the proliferation of normal cells by interacting strongly with CDK4 and CDK6. This inhibits their ability to interact with cyclins D and to phosphorylate the retinoblastoma protein.

PTMs:

Phosphorylation seems to increase interaction with CDK4.

Subcellular Location:

Cytoplasm. Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Widely expressed but not detected in brain or skeletal muscle. Isoform 3 is pancreas-specific.

Family&Domains:

Belongs to the CDKN2 cyclin-dependent kinase inhibitor family.

Research Fields

· Cellular Processes > Cell growth and death > Cell cycle.   (View pathway)

· Cellular Processes > Cell growth and death > p53 signaling pathway.   (View pathway)

· Cellular Processes > Cell growth and death > Cellular senescence.   (View pathway)

· Human Diseases > Drug resistance: Antineoplastic > Endocrine resistance.

· Human Diseases > Drug resistance: Antineoplastic > Platinum drug resistance.

· Human Diseases > Infectious diseases: Viral > HTLV-I infection.

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Overview > Viral carcinogenesis.

· Human Diseases > Cancers: Overview > MicroRNAs in cancer.

· Human Diseases > Cancers: Specific types > Pancreatic cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Glioma.   (View pathway)

· Human Diseases > Cancers: Specific types > Melanoma.   (View pathway)

· Human Diseases > Cancers: Specific types > Bladder cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Chronic myeloid leukemia.   (View pathway)

· Human Diseases > Cancers: Specific types > Non-small cell lung cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Hepatocellular carcinoma.   (View pathway)

References

1). Senescent-like macrophages mediate angiogenesis for endplate sclerosis via IL-10 secretion in male mice. Nature communications, 2024 (PubMed: 38580630) [IF=16.6]

Application: IF/ICC    Species: Mouse    Sample:

Fig. 6: Knockout of cdkn2a (p16) in Lyz2+ cells abrogates LSI-induced endplate sclerosis. a Representative immunofluorescent images of p16+ (red), F4/80+ (green) cells and DAPI (blue) staining of nuclei in mouse caudal endplates of L4/5 in Cdkn2aΔLyz2 or Cdkn2af/f mice at 8 weeks after LSI or sham surgery. Scale bars, 50 μm. b Representative immunofluorescent images of CD31 (green), Emcn (red) and DAPI (blue) staining of nuclei in the endplates of Cdkn2aΔLyz2 or Cdkn2af/f mice after LSI or sham surgery. Scale bars, 50 μm. c Permillage of CD31+Emcn+ area in the endplates of b. d Representative µCT images of the caudal endplates of L4/5 (coronal view) in Cdkn2aΔLyz2 or Cdkn2af/f mice at 8 weeks after LSI or sham surgery. Scale bars, 500 μm. e Quantitative analysis of the total porosity of d. f Representative images of safranin O and fast green staining of endplates in Cdkn2aΔLyz2 or Cdkn2af/f mice at 8 weeks after LSI or sham surgery. Scale bars, 50 μm. g Endplate scores of the endplates of f. h Representative immunohistochemical images of Osterix (Osx) in the endplates of Cdkn2aΔLyz2 or Cdkn2af/f mice at 8 weeks after LSI or sham surgery. Scale bars, 50 μm. i Quantitative analysis of the number of Osx+ cells in the endplates of h. j Representative images of immunofluorescent analysis of CGRP+ sensory nerves (red) and DAPI (blue) staining of nuclei in the endplates of Cdkn2aΔLyz2 or Cdkn2af/f mice after LSI or sham surgery. Scale bars, 50 μm. k Permillage of CGRP+ area in the endplates of l. n = 6 per group. Data are represented as means ± standard deviations, as determined by One-way ANOVA. Source data are provided as a Source Data file.
2). Morusin Alleviates Aortic Valve Calcification by Inhibiting Valve Interstitial Cell Senescence Through Ccnd1/Trim25/Nrf2 Axis. Advanced science (Weinheim, Baden-Wurttemberg, Germany), 2024 (PubMed: 38502885) [IF=15.1]
3). Sirt3-mediated mitophagy regulates AGEs-induced BMSCs senescence and senile osteoporosis. Redox Biology, 2021 (PubMed: 33662874) [IF=10.7]

Application: WB    Species: mice    Sample: bone marrow mesenchymal stem (BMSCs)

Fig. 1. Effects of AGEs in different concentrations on the senescence of BMSCs. The BMSCs were treated with AGEs (50–200 μg/mL) or BSA for 24–72 h. (A) SA-β-gal assay for detection of BMSCs senescence. Scale bar: 100 μm. (B) Detection of H3K9me3 by immunofluorescence in BMSCs. Scale bar: 100 μm. (C) Detection of γ-H2AX by immunofluorescence in BMSCs. Scale bar: 100 μm. (D–I) Representative Western blotting assay and quantitation of the level of P16, P21, P53. **p < 0.01 versus BSA.
4). Heme oxygenase-1 prevents heart against myocardial infarction by attenuating ischemic injury-induced cardiomyocytes senescence. EBioMedicine, 2019 (PubMed: 30527623) [IF=9.7]
5). The brain-protective mechanism of fecal microbiota transplantation from young donor mice in the natural aging process via exosome, gut microbiota, and metabolomics analyses. Pharmacological research, 2024 (PubMed: 39053865) [IF=9.1]
6). VDR activation attenuates osteoblastic ferroptosis and senescence by stimulating the Nrf2/GPX4 pathway in age-related osteoporosis. Free Radical Biology and Medicine, 2022 (PubMed: 36402439) [IF=7.1]
7). Dihydromyricetin regulates the miR-155-5p/SIRT1/VDAC1 pathway to promote liver regeneration and improve alcohol-induced liver injury. Phytomedicine : international journal of phytotherapy and phytopharmacology, 2025 (PubMed: 39986231) [IF=6.7]
8). Oxygen–Glucose Deprivation Promoted Fibroblast Senescence and Collagen Expression via IL11. International Journal of Molecular Sciences, 2022 (PubMed: 36292942) [IF=5.6]
9). Research on the anti-aging mechanisms of Panax ginseng extract in mice: a gut microbiome and metabolomics approach. Frontiers in pharmacology, 2024 (PubMed: 38966558) [IF=5.6]
10). Mechanistic study of the regulation of mitochondrial function by the GPNMB/Nrf2/NF-κB signaling pathway mediated by Quzhi Tang to alleviate chondrocyte senescence. Journal of ethnopharmacology, 2024 (PubMed: 39617085) [IF=5.4]
Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.