Product: AMACR Antibody
Catalog: DF6265
Description: Rabbit polyclonal antibody to AMACR
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 42kDa; 42kD(Calculated).
Uniprot: Q9UHK6
RRID: AB_2838231

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
AMACR Antibody detects endogenous levels of total AMACR.
RRID:
AB_2838231
Cite Format: Affinity Biosciences Cat# DF6265, RRID:AB_2838231.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

2 arylpropionyl CoA epimerase; 2 methylacyl CoA racemase; 2-methylacyl-CoA racemase; Alpha methylacyl CoA racemase; Alpha methylacyl Coenzyme A racemase; Alpha methylacyl-CoA racemase deficiency, included; Alpha-methylacyl-CoA racemase; Amacr; AMACR deficiency, included; AMACR_HUMAN; CBAS4; Da1-8; EC 5.1.99.4; Macr1; Methylacyl CoA racemase alpha; RACE; RM;

Immunogens

Immunogen:

A synthesized peptide derived from human AMACR, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Description:
α-methylacyl-CoA racemase (AMACR), an enzyme localized in peroxisomes and mitochondria, is involved in the β-oxidation of branched-chain fatty acids and fatty acid derivatives (1). AMACR has been reported to be a biomarker for prostate cancer (2-4). The expression of AMACR is also related to other types of cancers such as hepatocellular carcinoma (1), noninvasive bladder cancer (5), colorectal cancer (6) and gastric adenocarcinoma (7).
Sequence:
MALQGISVVELSGLAPGPFCAMVLADFGARVVRVDRPGSRYDVSRLGRGKRSLVLDLKQPRGAAVLRRLCKRSDVLLEPFRRGVMEKLQLGPEILQRENPRLIYARLSGFGQSGSFCRLAGHDINYLALSGVLSKIGRSGENPYAPLNLLADFAGGGLMCALGIIMALFDRTRTGKGQVIDANMVEGTAYLSSFLWKTQKLSLWEAPRGQNMLDGGAPFYTTYRTADGEFMAVGAIEPQFYELLIKGLGLKSDELPNQMSMDDWPEMKKKFADVFAEKTKAEWCQIFDGTDACVTPVLTFEEVVHHDHNKERGSFITSEEQDVSPRPAPLLLNTPAIPSFKRDPFIGEHTEEILEEFGFSREEIYQLNSDKIIESNKVKASL

Research Backgrounds

Function:

Catalyzes the interconversion of (R)- and (S)-stereoisomers of alpha-methyl-branched-chain fatty acyl-CoA esters. Acts only on coenzyme A thioesters, not on free fatty acids, and accepts as substrates a wide range of alpha-methylacyl-CoAs, including pristanoyl-CoA, trihydroxycoprostanoyl-CoA (an intermediate in bile acid synthesis), and arylpropionic acids like the anti-inflammatory drug ibuprofen (2-(4-isobutylphenyl)propionic acid) but neither 3-methyl-branched nor linear-chain acyl-CoAs.

Subcellular Location:

Peroxisome. Mitochondrion.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the CoA-transferase III family.

Research Fields

· Cellular Processes > Transport and catabolism > Peroxisome.   (View pathway)

· Metabolism > Lipid metabolism > Primary bile acid biosynthesis.

· Metabolism > Global and overview maps > Metabolic pathways.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.