Product: TIMP3 Antibody
Catalog: DF6432
Description: Rabbit polyclonal antibody to TIMP3
Application: WB IHC IF/ICC
Cited expt.: WB
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus
Mol.Wt.: 24kDa; 24kD(Calculated).
Uniprot: P35625
RRID: AB_2838395

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(86%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%), Chicken(100%), Xenopus(100%)
Clonality:
Polyclonal
Specificity:
TIMP3 Antibody detects endogenous levels of total TIMP3.
RRID:
AB_2838395
Cite Format: Affinity Biosciences Cat# DF6432, RRID:AB_2838395.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

HSMRK222; K222; K222TA2; Metalloproteinase inhibitor 3; MIG 5 protein; MIG5 protein; Protein MIG 5; Protein MIG-5; SFD; Sorsby fundus dystrophy pseudoinflammatory; TIMP 3; TIMP metallopeptidase inhibitor 3; TIMP-3; TIMP3; TIMP3_HUMAN; Tissue Inhibitor of Metalloproteinase 3; Tissue inhibitor of metalloproteinases 3; Tissue inhibitor of metalloproteinases3;

Immunogens

Immunogen:

A synthesized peptide derived from human TIMP3, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Description:
TIMPs are members of the family of tissue inhibitor of matrix metalloproteinases (MMPs) that includes TIMP1, TIMP2, TIMP3, and TIMP4. The main function of TIMPs is their inhibitory effect on MMPs. TIMPs irreversibly inactivate MMPs by direct binding to their catalytic zinc cofactor and resultant inhibition of proteinase function (1,2). In addition to MMP inhibition, TIMPs have also been shown to interact with various membrane receptors on the cell surface. Some of these interactions include: TIMP1 with CD63, TIMP2 with α3β1 integrin, and TIMP3 with VEGFR2, all of which result in distinct cellular effects (3). TIMPs are involved in a wide variety of biological functions, such as tumor angiogenesis and progression (4,5), wound healing, and vascular remodeling (6,7). Mutations in TIMP3 are associated with Sorsby's fundus dystrophy (8,9).
Sequence:
MTPWLGLIVLLGSWSLGDWGAEACTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINATDP

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Sheep
100
Dog
100
Xenopus
100
Chicken
100
Rabbit
100
Bovine
86
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. May form part of a tissue-specific acute response to remodeling stimuli. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-9, MMP-13, MMP-14 and MMP-15.

Subcellular Location:

Secreted>Extracellular space>Extracellular matrix.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the protease inhibitor I35 (TIMP) family.

Research Fields

· Human Diseases > Cancers: Overview > Proteoglycans in cancer.

· Human Diseases > Cancers: Overview > MicroRNAs in cancer.

References

1). Undercarboxylated OCN Inhibits Chondrocyte Hypertrophy and Osteoarthritis Development through GPRC6A/HIF-1α Cascade. International journal of biological sciences, 2025 (PubMed: 40765832) [IF=8.2]

Application: WB    Species: Mouse    Sample:

Figure 1. OCN deficiency leads to increased chondrocyte hypertrophy. (A) Safranin O and fast green staining of representative paraffin sections of femora of the newborn WT mice. The white boxes depict regions of higher magnification of the hypertrophic zone of the growth plate as shown on the right. The arrows depict the hypertrophic chondrocytes. Statistical analysis of the proportion of relatively hypertrophic chondrocytes is shown on the right. (n = 5 mice per group). (B) Immunohistochemistry (IHC) staining of representative paraffin sections of COL2a1, MMP13 and COL10a1 expression in articular cartilage of WT mice and OCN-/- mice. The black boxes depict regions of higher magnification. Statistical analysis is on the right. (n=7 mice per group). (C) Gene expression analysis of hypertrophic markers of primary chondrocytes isolated from WT and OCN-/- newborn mice after monolayer culture. (D) Gene expression analysis of hypertrophic markers of primary chondrocytes isolated from WT and OCN-/- newborn mice after 3D micromass culture for 21 days. (E) IHC staining of representative paraffin sections of MMP13 and COL10a1 expression in chondrocytes of WT and OCN-/- newborn mice after 3D micromass culture for 21 days. The black boxes depict regions of higher magnification. Grade map visualization displayed by the Slide Viewer software is shown below, red represents the intensity of staining (n=3 per group). Statistical analysis is on the right. Scale bar, 100 μm. WT, wild type. OCN-/-, OCN knockout. Student's t-test for two groups, one-way ANOVA for three or more.

2). Inhibitors of PARP-1 exert inhibitory effects on the biological characteristics of hepatocellular carcinoma cells in vitro. Molecular Medicine Reports, 2017 (PubMed: 28498459) [IF=3.4]

Application: WB    Species: human    Sample: HepG2

Figure 6. Effects of different concentrations of AG014699 and BSI‑201 on protein levels of PTEN, TIMP3 and MMP3 in HepG2 cells. (A) Blots showing protein expression following treatment with AG014699 and (B) quantification. (C) Blots showing protein expression following treatment with BSI‑201 and (D) quantification. * P<0.05, compared with the control group; ∆P<0.05, compared with the low dose group, ∆∆P<0.05, compared with the middle dose group. MMP, matrix metalloproteinase; TIMP 3, tissue inhibitor of metalloproteinase 3; PTEN, phosphatase and tensin homolog; CTRL, control.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.