Product: Caspase 7 Antibody
Catalog: DF6441
Description: Rabbit polyclonal antibody to Caspase 7
Application: WB IHC IF/ICC
Cited expt.: WB
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog
Mol.Wt.: 43 kDa; 34kD(Calculated).
Uniprot: P55210
RRID: AB_2838404

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(90%), Bovine(100%), Horse(90%), Sheep(100%), Rabbit(100%), Dog(100%)
Clonality:
Polyclonal
Specificity:
Caspase 7 Antibody detects endogenous levels of total Caspase 7.
RRID:
AB_2838404
Cite Format: Affinity Biosciences Cat# DF6441, RRID:AB_2838404.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Apoptotic protease Mch-3; Apoptotic protease MCH3; CASP-7; CASP7; CASP7_HUMAN; Caspase 7; Caspase 7 apoptosis related cysteine peptidase; Caspase-7 subunit p11; Caspase7; CMH 1; CMH-1; CMH1; ICE LAP3; ICE-LAP3; ICE-like apoptotic protease 3; LICE2; MCH3;

Immunogens

Immunogen:

A synthesized peptide derived from human Caspase 7, corresponding to a region within N-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
P55210 CASP7_HUMAN:

Highly expressed in lung, skeletal muscle, liver, kidney, spleen and heart, and moderately in testis. No expression in the brain.

Description:
Caspase-7 (CMH-1, Mch3, ICE-LAP3) has been identified as a major contributor to the execution of apoptosis (1-4). Caspase-7, like caspase-3, is an effector caspase that is responsible for cleaving downstream substrates such as (ADP-ribose) polymerase and PARP (1,3). During apoptosis, caspase-7 is activated through proteolyticprocesssing by upstream caspases at Asp23, Asp198, and Asp206 to produce the mature subunits (1,3). Similar to caspases-2 and -3, caspase-7 preferentially cleaves substrates following the recognition sequence DEVD (5).
Sequence:
MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Bovine
100
Sheep
100
Dog
100
Rabbit
100
Pig
90
Horse
90
Chicken
57
Xenopus
44
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Involved in the activation cascade of caspases responsible for apoptosis execution. Cleaves and activates sterol regulatory element binding proteins (SREBPs). Proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond. Overexpression promotes programmed cell death.

PTMs:

Cleavages by granzyme B or caspase-10 generate the two active subunits. Propeptide domains can also be cleaved efficiently by caspase-3. Active heterodimers between the small subunit of caspase-7 and the large subunit of caspase-3, and vice versa, also occur.

Subcellular Location:

Cytoplasm.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Highly expressed in lung, skeletal muscle, liver, kidney, spleen and heart, and moderately in testis. No expression in the brain.

Family&Domains:

Belongs to the peptidase C14A family.

Research Fields

· Cellular Processes > Cell growth and death > Apoptosis.   (View pathway)

· Cellular Processes > Cell growth and death > Apoptosis - multiple species.   (View pathway)

· Environmental Information Processing > Signal transduction > TNF signaling pathway.   (View pathway)

· Human Diseases > Endocrine and metabolic diseases > Non-alcoholic fatty liver disease (NAFLD).

· Human Diseases > Neurodegenerative diseases > Alzheimer's disease.

· Human Diseases > Infectious diseases: Bacterial > Pertussis.

· Human Diseases > Infectious diseases: Bacterial > Legionellosis.

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

References

1). Precise editing of FGFR3-TACC3 fusion genes with CRISPR-Cas13a in glioblastoma. Molecular Therapy, 2021 (PubMed: 34274537) [IF=12.1]

2). Combination LSD1 and HOTAIR-EZH2 inhibition disrupts cell cycle processes and induces apoptosis in glioblastoma cells. PHARMACOLOGICAL RESEARCH, 2021 (PubMed: 34246782) [IF=9.1]

Application: WB    Species: Mice    Sample: GBM cells

Fig. 5. Combination GSK-LSD1 + AQB pro- motes apoptosis by targeting BBC3 in vitro. (A) mRNA levels of BBC3 measured by qPCR after treatment 100 µM GSK-LSD1, 40 µM AQB, or 100 µM GSK-LSD1 + 40 µM AQB for 48 h. (B) Relative BBC3 mRNA levels after treat- ment with 100 µM GSK-LSD1, 40 µM AQB, or their combination after 12, 24, 48, or 72 h. (C) Relative BBC3 mRNA levels measured by qPCR after treatment with indicated concen- trations of AQB or GSK-LSD1 for 48 h. (D) Combination treatment effects on BBC3 mRNA levels at varied concentrations. (E) Western blot analysis of PUMA, Caspase 3, Caspase 7 after treatment with indicated concentrations of AQB for 48 h. (F) Western blot analysis of PUMA, Caspase 3, Caspase 7 after treatment with 200 µM GSK-LSD1, 80 µM AQB, or 200 µM GSK-LSD1 + 80 µM AQB for 48 h. (G) Apoptosis detection after 48 h of treatment with 200 µM GSK-LSD1, 80 µM AQB, or 200 µM GSK-LSD1 + 80 µM AQB. (H) Immunofluorescence assay for PUMA expression after the treatment with 100 µM GSK-LSD1, 40 µM AQB, or 100 µM GSK-LSD1 + 40 µM AQB for 48 h. Data are represented as mean ± s.d.; n = 3 indepen- dent experiments. ****P < 0.0001, ***P < 0.001, **P < 0.01, *P < 0.05.

3). CircGCN1L1 promotes synoviocyte proliferation and chondrocyte apoptosis by targeting miR-330-3p and TNF-α in TMJ osteoarthritis. Cell Death & Disease, 2020 (PubMed: 32332704) [IF=8.1]

4). Long non-coding RNA RP11-197K6.1 as ceRNA promotes colorectal cancer progression via miR-135a-5p/DLX5 axis. Journal of translational medicine, 2024 (PubMed: 38760791) [IF=7.4]

Application: WB    Species: Human    Sample: HCT116 and SW480 cells

Fig. 2 Functional effects of lncRNA RP11-197K6.1 knockdown in CRC cells. A: Confirmation of lncRNA RP11-197K6.1 knockdown efficiency in HCT116 cells by RT-qPCR. B: Reduction in the proliferation of HCT116 and SW480 cells post-knockdown, as determined by proliferation assays. C: Increase in the apoptosis of HCT116 and SW480 cells following lncRNA RP11-197K6.1 knockdown, as measured by flow cytometry. D & E: Decrease in the migration and invasion of HCT116 and SW480 cells post-knockdown, as assessed by wound healing (scale = 200 μm) and Transwell assays (scale = 50 μm), respectively. 2 F: Changes in the levels of proteins related to the proliferation, apoptosis, and migration of HCT116 and SW480 cells after lncRNA RP11-197K6.1 knockdown, as analyzed by western blotting assay (**P 

5). WTAP-Mediated m6A Modification of circSMOC1 Accelerates the Tumorigenesis of Non-Small Cell Lung Cancer by Regulating miR-612/CCL28 Axis. Journal of cellular and molecular medicine, 2024 (PubMed: 39632285) [IF=5.3]

6). Fufang Baizhi tincture protects melanocytes from oxidative stress by targeting CASP7-mediated apoptosis and EP300-associated transcriptional regulation. Journal of ethnopharmacology, 2026 (PubMed: 41713816) [IF=4.8]

7). MSC-Derived Exosomes Ameliorate Intervertebral Disc Degeneration By Regulating the Keap1/Nrf2 Axis. Stem Cell Reviews and Reports, 2023 (PubMed: 37528254) [IF=4.5]

8). Cytokeratin 13 promotes radiotherapy sensitivity of nasopharyngeal carcinoma by downregulating the MEK/ERK pathway. IUBMB LIFE, 2022 (PubMed: 35426961) [IF=3.7]

9). Nickel Sulfate-Induced GSIS Injury in MIN6 Cells by Activating the JNK Pathway Through Oxidative Stress. Biological trace element research, 2024 (PubMed: 39661292) [IF=3.4]

10). Bacillus subtilis alleviates excessive apoptosis of intestinal epithelial cells in intrauterine growth restriction suckling piglets via the members of Bcl-2 and caspase families. Journal of the science of food and agriculture, 2024 (PubMed: 38597265) [IF=3.3]

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.