POLR2L Antibody - #DF6960
| Product: | POLR2L Antibody |
| Catalog: | DF6960 |
| Description: | Rabbit polyclonal antibody to POLR2L |
| Application: | WB IHC |
| Cited expt.: | IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Chicken |
| Mol.Wt.: | 7kDa; 8kD(Calculated). |
| Uniprot: | P62875 |
| RRID: | AB_2838916 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6960, RRID:AB_2838916.
Fold/Unfold
and III subunit ABC5; and III subunit RPABC5; DNA directed RNA polymerase II polypeptide L; DNA-directed RNA polymerase III subunit L; DNA-directed RNA polymerases I; hRPB7.6; hsRPB10b; II; POLR2L; RNA polymerase II 7.6 kDa subunit; RNA polymerase II polypeptide L; RNA polymerases I; RPAB5_HUMAN; RPABC5; RPB10; RPB10 homolog; RPB10beta; RPB7.6;
Immunogens
A synthesized peptide derived from human POLR2L, corresponding to a region within the internal amino acids.
- P62875 RPAB5_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and a small RNAs, such as 5S rRNA and tRNAs, respectively. Pol II is the central component of the basal RNA polymerase II transcription machinery. Pols are composed of mobile elements that move relative to each other. In Pol II, POLR2L/RBP10 is part of the core element with the central large cleft (By similarity).
Nucleus.
Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.
Research Fields
· Genetic Information Processing > Transcription > RNA polymerase.
· Human Diseases > Neurodegenerative diseases > Huntington's disease.
· Human Diseases > Infectious diseases: Viral > Epstein-Barr virus infection.
· Metabolism > Nucleotide metabolism > Purine metabolism.
· Metabolism > Nucleotide metabolism > Pyrimidine metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
· Organismal Systems > Immune system > Cytosolic DNA-sensing pathway. (View pathway)
References
Application: IHC Species: human Sample: HCC tissue
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.