Product: Bcl-2 Antibody
Catalog: AF0769
Description: Rabbit polyclonal antibody to Bcl-2
Application: WB IHC IF/ICC
Cited expt.: WB
Reactivity: Human
Mol.Wt.: 28kDa(Observed); 26kD(Calculated).
Uniprot: P10415
RRID: AB_2834113

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Polyclonal
Specificity:
Bcl-2 Antibody detects endogenous levels of total Bcl-2.
RRID:
AB_2834113
Cite Format: Affinity Biosciences Cat# AF0769, RRID:AB_2834113.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Apoptosis regulator Bcl 2; Apoptosis regulator Bcl-2; Apoptosis regulator Bcl2; AW986256; B cell CLL/lymphoma 2; B cell leukemia/lymphoma 2; Bcl-2; Bcl2; BCL2_HUMAN; C430015F12Rik; D630044D05Rik; D830018M01Rik; Leukemia/lymphoma, B-cell, 2; Oncogene B-cell leukemia 2; PPP1R50; Protein phosphatase 1, regulatory subunit 50;

Immunogens

Immunogen:

A synthesized peptide derived from human Bcl-2, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
P10415 BCL2_HUMAN:

Expressed in a variety of tissues.

Description:
This gene encodes an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy chain locus, is thought to be the cause of follicular lymphoma. Two transcript variants, produced by alternate splicing, differ in their C-terminal ends.
Sequence:
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK

Research Backgrounds

Function:

Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1). May attenuate inflammation by impairing NLRP1-inflammasome activation, hence CASP1 activation and IL1B release.

PTMs:

Phosphorylation/dephosphorylation on Ser-70 regulates anti-apoptotic activity. Growth factor-stimulated phosphorylation on Ser-70 by PKC is required for the anti-apoptosis activity and occurs during the G2/M phase of the cell cycle. In the absence of growth factors, BCL2 appears to be phosphorylated by other protein kinases such as ERKs and stress-activated kinases. Phosphorylated by MAPK8/JNK1 at Thr-69, Ser-70 and Ser-87, wich stimulates starvation-induced autophagy. Dephosphorylated by protein phosphatase 2A (PP2A) (By similarity).

Proteolytically cleaved by caspases during apoptosis. The cleaved protein, lacking the BH4 motif, has pro-apoptotic activity, causes the release of cytochrome c into the cytosol promoting further caspase activity.

Monoubiquitinated by PRKN, leading to increase its stability. Ubiquitinated by SCF(FBXO10), leading to its degradation by the proteasome.

Subcellular Location:

Mitochondrion outer membrane>Single-pass membrane protein. Nucleus membrane>Single-pass membrane protein. Endoplasmic reticulum membrane>Single-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in a variety of tissues.

Family&Domains:

BH1 and BH2 domains are required for the interaction with BAX and for anti-apoptotic activity.

The BH4 motif is required for anti-apoptotic activity and for interaction with RAF1 and EGLN3.

The loop between motifs BH4 and BH3 is required for the interaction with NLRP1.

Belongs to the Bcl-2 family.

Research Fields

· Cellular Processes > Transport and catabolism > Autophagy - animal.   (View pathway)

· Cellular Processes > Cell growth and death > Apoptosis.   (View pathway)

· Cellular Processes > Cell growth and death > Apoptosis - multiple species.   (View pathway)

· Cellular Processes > Cell growth and death > Necroptosis.   (View pathway)

· Cellular Processes > Cellular community - eukaryotes > Focal adhesion.   (View pathway)

· Environmental Information Processing > Signal transduction > NF-kappa B signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > HIF-1 signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Sphingolipid signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Hedgehog signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Jak-STAT signaling pathway.   (View pathway)

· Genetic Information Processing > Folding, sorting and degradation > Protein processing in endoplasmic reticulum.   (View pathway)

· Human Diseases > Drug resistance: Antineoplastic > EGFR tyrosine kinase inhibitor resistance.

· Human Diseases > Drug resistance: Antineoplastic > Endocrine resistance.

· Human Diseases > Drug resistance: Antineoplastic > Platinum drug resistance.

· Human Diseases > Neurodegenerative diseases > Amyotrophic lateral sclerosis (ALS).

· Human Diseases > Infectious diseases: Parasitic > Toxoplasmosis.

· Human Diseases > Infectious diseases: Bacterial > Tuberculosis.

· Human Diseases > Infectious diseases: Viral > Hepatitis B.

· Human Diseases > Infectious diseases: Viral > Epstein-Barr virus infection.

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Overview > MicroRNAs in cancer.

· Human Diseases > Cancers: Specific types > Colorectal cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Prostate cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Small cell lung cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Gastric cancer.   (View pathway)

· Organismal Systems > Circulatory system > Adrenergic signaling in cardiomyocytes.   (View pathway)

· Organismal Systems > Immune system > NOD-like receptor signaling pathway.   (View pathway)

· Organismal Systems > Nervous system > Neurotrophin signaling pathway.   (View pathway)

· Organismal Systems > Nervous system > Cholinergic synapse.

· Organismal Systems > Endocrine system > Estrogen signaling pathway.   (View pathway)

References

1). A novel long non-coding RNA LINC00355 promotes proliferation of lung adenocarcinoma cells by down-regulating miR-195 and up-regulating the expression of CCNE1. CELLULAR SIGNALLING, 2020 (PubMed: 31689506) [IF=4.4]

2). C/EBPα-mediated transcriptional activation of miR-134-5p entails KPNA3 inhibition and modulates focal hypoxic-ischemic brain damage in neonatal rats. BRAIN RESEARCH BULLETIN, 2020 (PubMed: 32814091) [IF=3.5]

Application: WB    Species: rat    Sample: PC12 cells

Fig. 3. |K, The mRNA and protein expression of apoptosis-related factors (Bax and Bcl-2) in PC12 cells was determined by RT-qPCR and Western blot analysis. Results were presented as mean ± standard deviation representative of at least three independent experiments. *p < 0.05 vs. sham or control (untreated PC12 cells) and # p < 0.05 vs. miR-134 antagomir + si-NC by one-way ANOVA with Tukey’s test and by Bonferronicorrected repeated measures ANOVA (panel E).

3). Inhibitors of PARP-1 exert inhibitory effects on the biological characteristics of hepatocellular carcinoma cells in vitro. Molecular Medicine Reports, 2017 (PubMed: 28498459) [IF=3.4]

Application: WB    Species: human    Sample: HepG2

Figure 4. Effects of different concentrations of AG014699 and BSI‑201 on protein levels of Caspase 3, Caspase 8, Bax and Bcl‑2 in HepG2 cells.(A) Blots showing proteins in cells treated with AGO14699 and (B) quantification. (C) Blots showing proteins in cells treated with (C) BSI‑201 and (D) quantification. * P<0.05, compared with the control group; ∆P<0.05, compared with the low dose group; ∆∆P<0.05, compared with the middle dose group. CTRL, control; Bcl‑2, B‑cell lymphoma 2; BAX, Bcl‑2‑associated X protein.

4). A tumor-suppressing role of TSPYL2 in thyroid cancer: Through interacting with SIRT1 and repressing SIRT1/AKT pathway. Experimental cell research, 2023 (PubMed: 37696385) [IF=3.3]

5). MTF2 facilitates the advancement of osteosarcoma through mediating EZH2/SFRP1/Wnt signaling. Journal of orthopaedic surgery and research, 2024 (PubMed: 39118123) [IF=2.8]

Application: WB    Species: Human    Sample: MG-63 cells

Fig. 2 MTF2 silence inhibits the aggressive biological events of MG-63 cells. A Examination of MTF2 expression by Western blot after transfection of shRNA-MTF2-1/2. B CCK-8 assay detected cell viability. C EDU staining detected cell proliferation. D Wound healing assay and E transwell assay measured cell migration and invasion. F Examination of EMT markers by Western blot. G Flow cytometry assay evaluated the cellular apoptotic rate. H Examination of apoptotic proteins by Western blot

6). The co‑treatment of metformin with flavone synergistically induces apoptosis through inhibition of PI3K/AKT pathway in breast cancer cells. Oncology Letters, 2018 (PubMed: 29552226) [IF=2.5]

Application: WB    Species: human    Sample: MDA‑MB‑231 and MCF‑7 cells

Figure 5. |The combination of metformin and flavone regulated downstream targets of p53. (A) Protein levels of Bcl‑2, Bax were detected with western blotting when MDA‑MB‑231 and MCF‑7 cells were treated with 0, 20 mM MET, 100 µM FLA and the combination of 20 mM MET:100 µM FLA for 24 h (*P<0.05, 20 mM MET vs. control, 20 mM MET:100 µM FLA vs. 20 mM MET), caspase3 were detected no significance and cleaved caspase3 were detected when MDA‑MB‑231 (*P<0.05, 20 mM MET vs. control; **P<0.01, 20 mM MET:100 µM FLA vs. 20 mM MET) and MCF‑7 cells (*P<0.05, 20 mM MET vs. control, 20 mM MET:100 µM FLA vs. 20 mM MET) were the same treatment, (B) and their densitometry results over β‑actin in at least three separate experiments. FLA, flavone; MET, metformin.

7). EFNA4 deletion suppresses the migration, invasion, stemness, and angiogenesis of gastric cancer cells through the inactivation of Pygo2/Wnt signaling. Histology and histopathology, 2024 (PubMed: 38953488) [IF=2.5]

Application: WB    Species: Human    Sample: AGS cells

Figure 3. Deletion of EFNA4 promotes apoptosis and represses the angiogenesis of AGS cells. (A) TUNEL staining detected cell apoptosis.(B) Western blot analysis ofapoptosis-associated proteins. (C) The endothelial cell tube formation assay detectedcell angiogenesis.(D)Western blot analysis of angiogenesis-associated proteins***P

8). Hyperoside Alleviates Helicobacter pylori-Induced Gastric Epithelial Cell Injury by Regulating Nrf2/HO-1 Signaling. Polish journal of microbiology, 2025 (PubMed: 40146790) [IF=2.0]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.