Urocortin Antibody - #AF0290
Product: | Urocortin Antibody |
Catalog: | AF0290 |
Description: | Rabbit polyclonal antibody to Urocortin |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Dog |
Mol.Wt.: | 13kDa; 13kD(Calculated). |
Uniprot: | P55089 |
RRID: | AB_2834167 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0290, RRID:AB_2834167.
Fold/Unfold
prepro-urocortin; Ucn; UCN1_HUMAN; UI; UROC; Urocortin; Urocortin precursor; urocortin, preproprotein; Urotensin I;
Immunogens
A synthesized peptide derived from human Urocortin, corresponding to a region within the internal amino acids.
Keratinocytes in epidermis and the outer and inner root sheaths of hair follicles, epithelium of sebaceous and sweat glands, erector pili muscle, cutaneous blood vessel walls, cutaneous nerves and dermal mononuclear cells (PubMed:10690896). Detected in plasma cells in the lamia propria in colon mucosa (PubMed:15531481) (at protein level). Expressed in pituitary and adrenal glands (PubMed:10690896). Detected in plasma cells in the lamia propria in colon mucosa (PubMed:15531481).
- P55089 UCN1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRQAGRAALLAALLLLVQLCPGSSQRSPEAAGVQDPSLRWSPGARNQGGGARALLLLLAERFPRRAGPGRLGLGTAGERPRRDNPSLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSVGK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Acts in vitro to stimulate the secretion of adrenocorticotropic hormone (ACTH). Binds with high affinity to CRF receptor types 1, 2-alpha, and 2-beta. Plays a role in the establishment of normal hearing thresholds (By similarity). Reduces food intake and regulates ghrelin levels in gastric body and plasma (By similarity).
Secreted.
Keratinocytes in epidermis and the outer and inner root sheaths of hair follicles, epithelium of sebaceous and sweat glands, erector pili muscle, cutaneous blood vessel walls, cutaneous nerves and dermal mononuclear cells. Detected in plasma cells in the lamia propria in colon mucosa (at protein level). Expressed in pituitary and adrenal glands. Detected in plasma cells in the lamia propria in colon mucosa.
Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.