ATP6V1G3 Antibody - #DF10005
Product: | ATP6V1G3 Antibody |
Catalog: | DF10005 |
Description: | Rabbit polyclonal antibody to ATP6V1G3 |
Application: | WB |
Reactivity: | Human |
Prediction: | Horse, Rabbit, Dog |
Mol.Wt.: | 14 kDa; 14kD(Calculated). |
Uniprot: | Q96LB4 |
RRID: | AB_2840585 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF10005, RRID:AB_2840585.
Fold/Unfold
ATP6G3; atp6v1g3; ATPase, H+ transporting, lysosomal (vacuolar proton pump) subunit G3; ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3; MGC119810; MGC119813; MGC130213; MGC130214; V ATPase 13 kDa subunit 3; V ATPase G subunit 3; V ATPase G3 subunit; V ATPase subunit G 3; V-ATPase 13 kDa subunit 3; V-ATPase subunit G 3; V-type proton ATPase subunit G 3; Vacuolar ATP synthase subunit G 3; Vacuolar proton pump G subunit 3; Vacuolar proton pump subunit G 3; Vacuolar proton pump, subunit G3; VATG3_HUMAN; Vma10;
Immunogens
A synthesized peptide derived from human ATP6V1G3, corresponding to a region within the internal amino acids.
- Q96LB4 VATG3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTSQSQGIHQLLQAEKRAKDKLEEAKKRKGKRLKQAKEEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYRATN
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Catalytic subunit of the peripheral V1 complex of vacuolar ATPase (V-ATPase). V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
Kidney.
Belongs to the V-ATPase G subunit family.
Research Fields
· Cellular Processes > Transport and catabolism > Phagosome. (View pathway)
· Environmental Information Processing > Signal transduction > mTOR signaling pathway. (View pathway)
· Human Diseases > Infectious diseases: Bacterial > Vibrio cholerae infection.
· Human Diseases > Infectious diseases: Bacterial > Epithelial cell signaling in Helicobacter pylori infection.
· Human Diseases > Immune diseases > Rheumatoid arthritis.
· Metabolism > Energy metabolism > Oxidative phosphorylation.
· Metabolism > Global and overview maps > Metabolic pathways.
· Organismal Systems > Nervous system > Synaptic vesicle cycle.
· Organismal Systems > Excretory system > Collecting duct acid secretion.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.