Caveolin 3 Antibody - #DF7547
| Product: | Caveolin 3 Antibody |
| Catalog: | DF7547 |
| Description: | Rabbit polyclonal antibody to Caveolin 3 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Dog |
| Mol.Wt.: | 17 kDa; 17kD(Calculated). |
| Uniprot: | P56539 |
| RRID: | AB_2841046 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7547, RRID:AB_2841046.
Fold/Unfold
CAV3; CAV3_HUMAN; Caveolin 3; Caveolin-3; LGMD1C; LQT9; M-caveolin; MGC126100; MGC126101; MGC126129; OTTHUMP00000115603; OTTHUMP00000207105; VIP 21; VIP21;
Immunogens
A synthesized peptide derived from human Caveolin 3, corresponding to a region within N-terminal amino acids.
- P56539 CAV3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHIYSLCIRTFCNPLFAALGQVCSSIKVVLRKEV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. May also regulate voltage-gated potassium channels. Plays a role in the sarcolemma repair mechanism of both skeletal muscle and cardiomyocytes that permits rapid resealing of membranes disrupted by mechanical stress (By similarity). Mediates the recruitment of CAVIN2 and CAVIN3 proteins to the caveolae.
Sumoylation with SUMO3 by PIAS4 may reduce agonist-induced internalization and desensitization of adrenergic receptor ABRD2.
Golgi apparatus membrane>Peripheral membrane protein. Cell membrane>Peripheral membrane protein. Membrane>Caveola>Peripheral membrane protein. Cell membrane>Sarcolemma.
Note: Potential hairpin-like structure in the membrane. Membrane protein of caveolae (By similarity).
Expressed predominantly in muscle.
Belongs to the caveolin family.
Research Fields
· Cellular Processes > Transport and catabolism > Endocytosis. (View pathway)
· Cellular Processes > Cellular community - eukaryotes > Focal adhesion. (View pathway)
· Human Diseases > Infectious diseases: Bacterial > Bacterial invasion of epithelial cells.
· Human Diseases > Cancers: Overview > Proteoglycans in cancer.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.