Phospho-MLC2 (Ser15) Antibody | Affinity Biosciences

Product:	Phospho-MLC2 (Ser15) Antibody
Catalog:	AF8618
Description:	Rabbit polyclonal antibody to Phospho-MLC2 (Ser15)
Application:	WB IHC IF/ICC
Reactivity:	Human, Mouse, Rat
Prediction:	Horse, Sheep, Rabbit, Dog, Chicken
Mol.Wt.:	18kDa; 19kD(Calculated).
Uniprot:	P10916
RRID:	AB_2846214

View similar products>>

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific.

Size	Price	Inventory
100ul	$280	In stock
200ul	$350	In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Related Downloads

MSDS

Data Sheet

COA

Protocols

WB Handbook

IHC Protocol

IF/ICC Protocol

Product Info

Source:

Rabbit

Application:

WB 1:200-1:2000, IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:

Human,Mouse,Rat

Prediction:

Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%), Chicken(100%)

Clonality:

Polyclonal

Specificity:

Phospho-MLC2 (Ser15) Antibody detects endogenous levels of MLC2 only when phosphorylated at Ser15.

RRID:

AB_2846214
Cite Format: Affinity Biosciences Cat# AF8618, RRID:AB_2846214.

Conjugate:

Unconjugated.

Purification:

The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.

Storage:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

Alias:

Fold/Unfold

Cardiac myosin light chain-2;Cardiac ventricular myosin light chain 2;CMH10;MLC 2v;MLC-2;MLC-2v;MLC2;MLRV_HUMAN;MYL 2;MYL2;Myosin light chain 2 regulatory cardiac slow;Myosin light polypeptide 2 regulatory cardiac slow;Myosin regulatory light chain 2;Myosin regulatory light chain 2 ventricular/cardiac muscle isoform;Regulatory light chain of myosin;RLC of myosin;Slow cardiac myosin regulatory light chain 2;ventricular/cardiac muscle isoform;

Immunogens

Immunogen:

Uniprot:

P10916(MLRV_HUMAN) >>Visit HPA database.

Gene(ID):

MYL2(4633)

Sequence:

P10916 MLRV_HUMAN:
Protein BLAST With
NCBI/
ExPASy/
Uniprot

MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species

Results

Score

Horse

100

Sheep

100

Dog

100

Chicken

100

Rabbit

100

Xenopus

Pig

Bovine

Zebrafish

Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P10916 As Substrate

P10916

Site	PTM Type	Enzyme	Source
S15	Phosphorylation	Q15746 (MYLK)	Uniprot
S19	Phosphorylation	Q5VT25 (CDC42BPA)	Uniprot
T80	Phosphorylation		Uniprot
T98	Phosphorylation		Uniprot
K104	Acetylation		Uniprot
K111	Acetylation		Uniprot
Y118	Phosphorylation		Uniprot
T124	Phosphorylation		Uniprot
Y152	Phosphorylation		Uniprot
K153	Acetylation		Uniprot
K165	Acetylation		Uniprot

Research Backgrounds

P10916_MLRV_HUMAN

Function:

Contractile protein that plays a role in heart development and function (By similarity). Following phosphorylation, plays a role in cross-bridge cycling kinetics and cardiac muscle contraction by increasing myosin lever arm stiffness and promoting myosin head diffusion; as a consequence of the increase in maximum contraction force and calcium sensitivity of contraction force. These events altogether slow down myosin kinetics and prolong duty cycle resulting in accumulated myosins being cooperatively recruited to actin binding sites to sustain thin filament activation as a means to fine-tune myofilament calcium sensitivity to force (By similarity). During cardiogenesis plays an early role in cardiac contractility by promoting cardiac myofibril assembly (By similarity).

PTMs:

N-terminus is methylated by METTL11A/NTM1.

Phosphorylated by MYLK3 and MYLK2; promotes cardiac muscle contraction and function (By similarity). Dephosphorylated by PPP1CB complexed to PPP1R12B (By similarity). The phosphorylated form in adult is expressed as gradients across the heart from endocardium (low phosphorylation) to epicardium (high phosphorylation); regulates cardiac torsion and workload distribution (By similarity).

Subcellular Location:

Cytoplasm>Myofibril>Sarcomere>A band.

Subunit Structure:

Myosin is a hexamer of 2 heavy chains and 4 light chains. Interacts with MYOC.

Research Fields

· Cellular Processes > Cellular community - eukaryotes > Focal adhesion. (View pathway)

· Cellular Processes > Cellular community - eukaryotes > Tight junction. (View pathway)

· Cellular Processes > Cell motility > Regulation of actin cytoskeleton. (View pathway)

· Environmental Information Processing > Signal transduction > Apelin signaling pathway. (View pathway)

· Human Diseases > Cardiovascular diseases > Hypertrophic cardiomyopathy (HCM).

· Human Diseases > Cardiovascular diseases > Dilated cardiomyopathy (DCM).

· Organismal Systems > Circulatory system > Cardiac muscle contraction. (View pathway)

· Organismal Systems > Circulatory system > Adrenergic signaling in cardiomyocytes. (View pathway)

· Organismal Systems > Immune system > Leukocyte transendothelial migration. (View pathway)

References

1). Polydopamine-mediated graphene oxide and nanohydroxyapatite-incorporated conductive scaffold with an immunomodulatory ability accelerates periodontal bone regeneration in diabetes. Bioactive Materials (PubMed: 35387166) [IF=18.9]

Application: WB Species: rat Sample: RAW 264.7 cells

Fig. S16. | Verification of transcriptome analysis of RAW 264.7 cells cultured on various scaffolds. The mRNA expression levels of (a) glycolytic and (b) RhoA/ROCK pathways-related genes in each group. (c) Western blot (WB) analysis of glycolytic and RhoA/ROCK pathways-related proteins HIF-1α, Pdk1, Pgk1, Cdc42, Rac1, and p-MLC/MLC in each group.

2). Protective effect of oxyberberine against acute lung injury in mice via inhibiting RhoA/ROCK signaling pathway. BIOMEDICINE & PHARMACOTHERAPY (PubMed: 35753262) [IF=7.5]

3). Walnut-Derived Peptide Improves Cognitive Impairment in Colitis Mice Induced by Dextran Sodium Sulfate via the Microbiota-Gut-Brain Axis (MGBA). Journal of agricultural and food chemistry (PubMed: 38039336) [IF=6.1]

4). β-patchoulene simultaneously ameliorated dextran sulfate sodium-induced colitis and secondary liver injury in mice via suppressing colonic leakage and flora imbalance. Biochemical Pharmacology (PubMed: 33017576) [IF=5.8]

Application: WB Species: mouse Sample: colon

Fig.4.| Effect of β-PAE on TLR4/MyD88/NF-κB and ROCK/MLC signalling pathway.(A) Representative bands of TLR4, MyD88, phospho-IκBα, IκBα and p65. (B)Quantitative results of band densities of TLR4, MyD88, phospho-IκBα, IκBα and p65.(C) Representative bands of ROCK1, phospho-MLC2 and MLC2.

Application: WB Species: mouse Sample: Colons

Fig.4. |Effect of β-PAE on TLR4/MyD88/NF-κB and ROCK/MLC signalling pathway. (C) Representative bands of ROCK1, phospho-MLC2 and MLC2. (D) Quantitative results of band densities of ROCK1, phospho-MLC2 and MLC2.

5). Echinococcus multilocularis drives the polarization of macrophages by regulating the RhoA-MAPK signaling pathway and thus affects liver fibrosis. Bioengineered (PubMed: 35324411) [IF=4.9]

Application: WB Species: Mouse Sample: RAW264.7 and Ana-1 cells

Figure 2. Protein levels of RhoA, ROCK1, ROCK2 and p-MLC in RAW264.7 and Ana-1 cells. *P < 0.05 vs. Control group, #P < 0.05 vs. AEm group.

6). Disruption of the lung-gut-brain axis is responsible for cortex damage induced by pulmonary exposure to zinc oxide nanoparticles. TOXICOLOGY (PubMed: 36535435) [IF=4.5]

7). Sarcomere length affects Ca2+ sensitivity of contraction in ischemic but not non-ischemic myocardium. JOURNAL OF GENERAL PHYSIOLOGY (PubMed: 36633584) [IF=3.8]

8). Inhibition of Peripheral ERK Signaling Ameliorates Persistent Muscle Pain Around Trigger Points in Rats. Cell Transplantation (PubMed: 33081508) [IF=3.3]

Application: WB Species: rat Sample: muscle

Figure 6. |MLCK might be the target of the ERK inhibitor involved in ameliorating muscular mechanical hyperalgesia. (C) The expression of p-MLC protein. p-MLC expression was increased in the MPS group compared with that in the control group. p-MLC expression was decreased in the ERK inhibitor group compared with that in the MPS group.

9). RHOA inhibits chondrogenic differentiation of mesenchymal stem cells in adolescent idiopathic scoliosis. CONNECTIVE TISSUE RESEARCH (PubMed: 35019797) [IF=2.9]

10). Brusatol-Enriched Brucea javanica Oil Ameliorated Dextran Sulfate Sodium-Induced Colitis in Mice: Involvement of NF-κB and RhoA/ROCK Signaling Pathways. Biomed Research International (PubMed: 34414236)

Application: WB Species: Mice Sample: colon tissue

Figure 7 BE-BJO inhibited the activation of the RhoA/ROCK signaling pathway in DSS-induced UC in mice. Representative Western Blot images of GTP RhoA, total RhoA, ROCK-1, p-MLC, and MLC (a). The relative protein expressions of GTP RhoA (b), ROCK-1 (c), and p-MLC (d) in colon tissue were detected by Western Blot. All values are presented as the mean ± SEM. ##P < 0.01 versus normal group; ∗P < 0.05, ∗∗P < 0.01, and ∗∗∗P < 0.001 versus DSS group.

Restrictive clause

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.

Phospho-MLC2 (Ser15) Antibody - #AF8618