Size Price Inventory
 100ul $140 280 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Mouse
Application:
IHC 1:50-1:200, IF/ICC 1:100-1:500, WB 1:500-1:2000, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.
Reactivity:
Human,Mouse,Rat
Clonality:
Monoclonal [AFB20122]
Specificity:
HO-1 Antibody detects endogenous levels of total HO-1.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

32 kD; bK286B10; D8Wsu38e; heat shock protein 32 kD; heat shock protein 32kD; Heat shock protein; Heme oxygenase (decycling) 1; Heme oxygenase 1; Hemox; HMOX 1; Hmox; Hmox1; HMOX1_HUMAN; HO 1; HO; HO-1; HO1; Hsp32;

Immunogens

Immunogen:

A synthesized peptide derived from human HO-1.

Uniprot:
Gene(ID):
Expression:
P09601 HMOX1_HUMAN:

Expressed at higher levels in renal cancer tissue than in normal tissue (at protein level).

Sequence:
MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM

PTMs - P09601 As Substrate

Site PTM Type Enzyme
K18 Acetylation
K18 Ubiquitination
K22 Ubiquitination
K39 Acetylation
K39 Ubiquitination
S53 Phosphorylation
Y55 Phosphorylation
Y58 Phosphorylation
K69 Ubiquitination
K86 Ubiquitination
T108 Phosphorylation
Y114 Phosphorylation
Y137 Phosphorylation
K148 Ubiquitination
K149 Ubiquitination
K153 Ubiquitination
S160 Phosphorylation
K177 Ubiquitination
K179 Ubiquitination
S188 Phosphorylation P31749 (AKT1)
T192 Phosphorylation
S229 Phosphorylation
S231 Phosphorylation
K243 Acetylation
K243 Ubiquitination
T252 Phosphorylation
K256 Acetylation
K256 Ubiquitination
Y286 Phosphorylation

Research Backgrounds

Function:

Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. Exhibits cytoprotective effects since excess of free heme sensitizes cells to undergo apoptosis.

Subcellular Location:

Microsome. Endoplasmic reticulum membrane>Peripheral membrane protein>Cytoplasmic side.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed at higher levels in renal cancer tissue than in normal tissue (at protein level).

Family&Domains:

Belongs to the heme oxygenase family.

Research Fields

· Cellular Processes > Cell growth and death > Ferroptosis.   (View pathway)

· Environmental Information Processing > Signal transduction > HIF-1 signaling pathway.   (View pathway)

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Overview > MicroRNAs in cancer.

· Human Diseases > Cancers: Specific types > Hepatocellular carcinoma.   (View pathway)

· Metabolism > Metabolism of cofactors and vitamins > Porphyrin and chlorophyll metabolism.

· Metabolism > Global and overview maps > Metabolic pathways.

· Organismal Systems > Digestive system > Mineral absorption.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.