Product: ATP1B1 Recombinant Rabbit mAb
Catalog: BF4079
Description: Rabbit monoclonal antibody to ATP1B1
Application: WB IHC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 45-55 kDa(Observed); 35kD(Calculated).
Uniprot: P05026

View similar products>>

Out of stock
Control Products

Product Info

Source:
Rabbit IgG
Application:
WB 1:1000-1:3000, IHC 1:50-1:100
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Clonality:
Monoclonal [ReFirm23526]
Specificity:
ATP1B1 Recombinant Rabbit mAb detects endogenous levels of ATP1B1.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Adenosinetriphosphatase; AT1B1_HUMAN; ATP 1B; ATP1B; ATP1B1; ATPase Na+/K+ transporting beta 1 polypeptide; Atpb 1; ATPBS; Beta 1 subunit of Na(+) K(+) ATPase; Na K ATPase beta 1 polypeptide; Na+/K+ ATPase beta 1 subunit; Sodium/potassium dependent ATPase beta 1 subunit; Sodium/potassium transporting ATPase beta 1 chain; Sodium/potassium transporting ATPase subunit beta 1; Sodium/potassium-dependent ATPase subunit beta-1; Sodium/potassium-transporting ATPase subunit beta-1;

Immunogens

Immunogen:

A synthetic peptide from human ATP1B1

Uniprot:
Gene(ID):
Expression:
P05026 AT1B1_HUMAN:

Found in most tissues.

Description:
The protein encoded by this gene belongs to the family of Na+,K+ and H+,K+ ATPases beta chain proteins,and to the subfamily of Na+,K+ -ATPases. Na+,K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation,for sodium-coupled transport of a variety of organic and inorganic molecules,and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits,a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates,through assembly of alpha,beta heterodimers,the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+,K+ -ATPase is encoded by multiple genes. This gene encodes a beta 1 subunit. Alternatively spliced transcript variants encoding different isoforms have been described,but their biological validity is not known.
Sequence:
MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS

Research Backgrounds

Function:

This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane.

Involved in cell adhesion and establishing epithelial cell polarity.

PTMs:

Glutathionylated.

Subcellular Location:

Cell membrane>Single-pass type II membrane protein. Cell membrane>Sarcolemma.
Note: Colocalizes with OBSCN at the intercalated disk and sarcolemma in cardiomyocytes. Localizes in long striations at the level of Z and M lines.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Found in most tissues.

Family&Domains:

The C-terminal lobe folds into an immunoglobulin-like domain and mediates cell adhesion properties.

Belongs to the X(+)/potassium ATPases subunit beta family.

Research Fields

· Environmental Information Processing > Signal transduction > cGMP-PKG signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > cAMP signaling pathway.   (View pathway)

· Organismal Systems > Circulatory system > Cardiac muscle contraction.   (View pathway)

· Organismal Systems > Circulatory system > Adrenergic signaling in cardiomyocytes.   (View pathway)

· Organismal Systems > Endocrine system > Insulin secretion.   (View pathway)

· Organismal Systems > Endocrine system > Thyroid hormone synthesis.

· Organismal Systems > Endocrine system > Thyroid hormone signaling pathway.   (View pathway)

· Organismal Systems > Endocrine system > Aldosterone synthesis and secretion.

· Organismal Systems > Excretory system > Aldosterone-regulated sodium reabsorption.

· Organismal Systems > Excretory system > Endocrine and other factor-regulated calcium reabsorption.

· Organismal Systems > Excretory system > Proximal tubule bicarbonate reclamation.

· Organismal Systems > Digestive system > Salivary secretion.

· Organismal Systems > Digestive system > Gastric acid secretion.

· Organismal Systems > Digestive system > Pancreatic secretion.

· Organismal Systems > Digestive system > Carbohydrate digestion and absorption.

· Organismal Systems > Digestive system > Protein digestion and absorption.

· Organismal Systems > Digestive system > Mineral absorption.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.