Product: Bak Antibody
Catalog: AF0119
Description: Rabbit polyclonal antibody to Bak
Application: WB IHC IF/ICC
Cited expt.: WB
Reactivity: Human, Mouse, Rat
Prediction: Bovine, Horse, Dog
Mol.Wt.: 25kDa; 23kD(Calculated).
Uniprot: Q16611
RRID: AB_2833303

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:3000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Bovine(89%), Horse(100%), Dog(89%)
Clonality:
Polyclonal
Specificity:
Bak Antibody detects endogenous levels of total Bak.
RRID:
AB_2833303
Cite Format: Affinity Biosciences Cat# AF0119, RRID:AB_2833303.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Apoptosis regulator BAK; BAK; BAK like; Bak NT; BAK_HUMAN; Bak1; Bcl 2 homologous antagonist/killer; Bcl 2 like 7 protein; Bcl-2 homologous antagonist/killer; Bcl-2-like protein 7; BCL2 antagonist/killer 1; Bcl2 like 7 Protein; Bcl2-L-7; BCL2L7; CDN1; Cell death inhibitor 1; MGC117255; MGC3887; NBak; Pro apoptotic protein BAK;

Immunogens

Immunogen:

A synthesized peptide derived from human Bak, corresponding to a region within N-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
Q16611 BAK_HUMAN:

Expressed in a wide variety of tissues, with highest levels in the heart and skeletal muscle.

Description:
Bak1 In the presence of an appropriate stimulus, accelerates programmed cell death by binding to, and antagonizing the anti- apoptotic action of BCL2 or its adenovirus homolog E1B 19k protein. Low micromolar levels of zinc ions inhibit the promotion of apoptosis. Belongs to the Bcl-2 family. Interacts with BCL2A1. Homodimer. Formation of the homodimer is zinc-dependent. Forms heterodimers with BCL2, E1B 19k protein, and BCL2L1 isoform Bcl-X(L). Interacts with myxoma virus protein M11L
Sequence:
MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Horse
100
Bovine
89
Dog
89
Pig
0
Sheep
0
Xenopus
0
Zebrafish
0
Chicken
0
Rabbit
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Plays a role in the mitochondrial apoptosic process. Upon arrival of cell death signals, promotes mitochondrial outer membrane (MOM) permeabilization by oligomerizing to form pores within the MOM. This releases apoptogenic factors into the cytosol, including cytochrome c, promoting the activation of caspase 9 which in turn processes and activates the effector caspases.

Subcellular Location:

Mitochondrion outer membrane>Single-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in a wide variety of tissues, with highest levels in the heart and skeletal muscle.

Family&Domains:

Intact BH3 motif is required by BIK, BID, BAK, BAD and BAX for their pro-apoptotic activity and for their interaction with anti-apoptotic members of the Bcl-2 family.

Belongs to the Bcl-2 family.

Research Fields

· Cellular Processes > Cell growth and death > Apoptosis.   (View pathway)

· Cellular Processes > Cell growth and death > Apoptosis - multiple species.   (View pathway)

· Genetic Information Processing > Folding, sorting and degradation > Protein processing in endoplasmic reticulum.   (View pathway)

· Human Diseases > Drug resistance: Antineoplastic > Platinum drug resistance.

· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.

· Human Diseases > Cancers: Overview > Viral carcinogenesis.

· Human Diseases > Cancers: Overview > MicroRNAs in cancer.

· Human Diseases > Cancers: Specific types > Colorectal cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Pancreatic cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Endometrial cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Glioma.   (View pathway)

· Human Diseases > Cancers: Specific types > Thyroid cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Basal cell carcinoma.   (View pathway)

· Human Diseases > Cancers: Specific types > Melanoma.   (View pathway)

· Human Diseases > Cancers: Specific types > Chronic myeloid leukemia.   (View pathway)

· Human Diseases > Cancers: Specific types > Small cell lung cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Non-small cell lung cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Breast cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Hepatocellular carcinoma.   (View pathway)

· Human Diseases > Cancers: Specific types > Gastric cancer.   (View pathway)

References

1). Injectable Hydrogel-Encapsulating Pickering Emulsion for Overcoming Lenvatinib-Resistant Hepatocellular Carcinoma via Cuproptosis Induction and Stemness Inhibition. Polymers, 2024 (PubMed: 39274051) [IF=5.0]

2). Bisimidazolium Salt Glycosyltransferase Inhibitors Suppress Hepatocellular Carcinoma Progression In Vitro and In Vivo. Pharmaceuticals, 2022 (PubMed: 35745636) [IF=4.6]

Application: WB    Species: Human    Sample: HepG2 cells

Figure 7 Treatment with C20/C22 induced ER stress and mitochondrial dysfunction increased the expression of proapoptotic proteins. HepG2 cells were treated with 2 and 3 μM of C20/C22 for 24 h. (A,B) WB analysis of the protein expression in HepG2 cells treated with 2 μM of C20/C22 for 0, 6, 12, and 24 h. The presented values correspond to the mean ± SD for three independent experiments. The p-value was analyzed by one-way ANOVA followed by Tukey’s test using GraphPad Prism version 8.00. *** p < 0.001, and **** p < 0.0001 vs. 0 h/control group. (C) JC-1 staining was performed to measure the MMP (n = 3), CCCP, and carbonyl cyanide 3-chlorophenylhydrazone. (D) C20/C22-treated cells were stained with DCFH-DA, and the relative levels of intracellular ROS were determined via fluorescence microscopy (n = 3). Scale bars, 50 µm.

3). lncRNA RP11-10A14. 5: a potential prognosis biomarker for LUAD through regulation on proliferation and metastasis. Discover-Oncology, 2022 (PubMed: 35575835) [IF=2.2]

Application: WB    Species: Human    Sample: H1299-RP11OV and H1299-∆RP11 cells

Fig. 5Effect of RP11-10A14.5 on the tumor metastasis markers and cell apoptosis. Relative expression of E-cadherin (A), Vimentin (B) and N-Cadherin (C) mRNA in H1299-RP11OV and H1299-∆RP11 cells. Expression of E-Cadherin (D), Vimentin (E) and N-Cadherin (F) in H1299-RP11OV and H1299-∆RP11 cells verified by IF. F Cell apoptosis rate of H1299-RP11OV and H1299-∆RP11 cells. G Relative expression of Caspase-3, Bax and Bak mRNA in H1299-RP11OV and H1299-∆RP11 cells. H Protein expression of Pro-Caspase-3, Cleaved-Caspase-3, Bak and Bax in H1299-RP11OV and H1299-∆RP11 cells.

4). Association of CUL4B with the pathogenesis of age-related cataract. International ophthalmology, 2024 (PubMed: 38937308) [IF=1.4]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.