Bak Antibody - #AF0119
![](/images/pubmed.gif)
Product: | Bak Antibody |
Catalog: | AF0119 |
Description: | Rabbit polyclonal antibody to Bak |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Bovine, Horse, Dog |
Mol.Wt.: | 25kDa; 23kD(Calculated). |
Uniprot: | Q16611 |
RRID: | AB_2833303 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0119, RRID:AB_2833303.
Fold/Unfold
Apoptosis regulator BAK; BAK; BAK like; Bak NT; BAK_HUMAN; Bak1; Bcl 2 homologous antagonist/killer; Bcl 2 like 7 protein; Bcl-2 homologous antagonist/killer; Bcl-2-like protein 7; BCL2 antagonist/killer 1; Bcl2 like 7 Protein; Bcl2-L-7; BCL2L7; CDN1; Cell death inhibitor 1; MGC117255; MGC3887; NBak; Pro apoptotic protein BAK;
Immunogens
Expressed in a wide variety of tissues, with highest levels in the heart and skeletal muscle.
- Q16611 BAK_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q16611 As Substrate
Research Backgrounds
Plays a role in the mitochondrial apoptosic process. Upon arrival of cell death signals, promotes mitochondrial outer membrane (MOM) permeabilization by oligomerizing to form pores within the MOM. This releases apoptogenic factors into the cytosol, including cytochrome c, promoting the activation of caspase 9 which in turn processes and activates the effector caspases.
Mitochondrion outer membrane>Single-pass membrane protein.
Expressed in a wide variety of tissues, with highest levels in the heart and skeletal muscle.
Homodimer. Formation of the homodimer is zinc-dependent. Forms heterodimers with BCL2 and BCL2L1 isoform Bcl-X(L). Forms heterooligomers with BAX. Interacts with BCL2A1 (By similarity). Interacts with RTL10/BOP. Interacts with VDAC1. Interacts with GIMAP3/IAN4 and GIMAP5/IAN5.
(Microbial infection) Interacts with vaccinia virus protein F1.
(Microbial infection) Interacts with myxoma virus protein M11L.
(Microbial infection) Interacts with Epstein-Barr virus protein BALF1.
(Microbial infection) Interacts with adenovirus protein E1B 19K.
Intact BH3 motif is required by BIK, BID, BAK, BAD and BAX for their pro-apoptotic activity and for their interaction with anti-apoptotic members of the Bcl-2 family.
Belongs to the Bcl-2 family.
Research Fields
· Cellular Processes > Cell growth and death > Apoptosis. (View pathway)
· Cellular Processes > Cell growth and death > Apoptosis - multiple species. (View pathway)
· Genetic Information Processing > Folding, sorting and degradation > Protein processing in endoplasmic reticulum. (View pathway)
· Human Diseases > Drug resistance: Antineoplastic > Platinum drug resistance.
· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.
· Human Diseases > Cancers: Overview > Pathways in cancer. (View pathway)
· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.
· Human Diseases > Cancers: Overview > Viral carcinogenesis.
· Human Diseases > Cancers: Overview > MicroRNAs in cancer.
· Human Diseases > Cancers: Specific types > Colorectal cancer. (View pathway)
· Human Diseases > Cancers: Specific types > Pancreatic cancer. (View pathway)
· Human Diseases > Cancers: Specific types > Endometrial cancer. (View pathway)
· Human Diseases > Cancers: Specific types > Glioma. (View pathway)
· Human Diseases > Cancers: Specific types > Thyroid cancer. (View pathway)
· Human Diseases > Cancers: Specific types > Basal cell carcinoma. (View pathway)
· Human Diseases > Cancers: Specific types > Melanoma. (View pathway)
· Human Diseases > Cancers: Specific types > Chronic myeloid leukemia. (View pathway)
· Human Diseases > Cancers: Specific types > Small cell lung cancer. (View pathway)
· Human Diseases > Cancers: Specific types > Non-small cell lung cancer. (View pathway)
· Human Diseases > Cancers: Specific types > Breast cancer. (View pathway)
· Human Diseases > Cancers: Specific types > Hepatocellular carcinoma. (View pathway)
· Human Diseases > Cancers: Specific types > Gastric cancer. (View pathway)
References
Application: WB Species: Human Sample: HepG2 cells
Application: WB Species: Human Sample: H1299-RP11OV and H1299-∆RP11 cells
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.