Product: Wnt1 Antibody
Catalog: AF5315
Source: Rabbit
Application: WB, IHC, IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken
Mol.Wt.: 41 kDa; 41kD(Calculated).
Uniprot: P04628
RRID: AB_2837800

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%), Chicken(91%)
Clonality:
Polyclonal
Specificity:
Wnt1 Antibody detects endogenous levels of total Wnt1.
RRID:
AB_2837800
Cite Format: Affinity Biosciences Cat# AF5315, RRID:AB_2837800.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

BMND16; INT1; OI15; oncogene Int1; Proto oncogene protein Wnt 1; Proto-oncogene Int-1 homolog; Proto-oncogene Wnt-1; Wingless type MMTV integration site family member 1; wingless-type MMTV integration site family, member 1 (oncogene INT1); Wnt 1; wnt1; WNT1_HUMAN;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Description:
Ligand for members of the frizzled family of seven transmembrane receptors. In some developmental processes, is also a ligand for the coreceptor RYK, thus triggering Wnt signaling. Probable developmental protein. May be a signaling molecule important in CNS development. Is likely to signal over only few cell diameters.
Sequence:
MGLWALLPGWVSATLLLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPSLQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNCTHTRVLHECL

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Rabbit
100
Chicken
91
Zebrafish
55
Xenopus
45
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P04628 As Substrate

Site PTM Type Enzyme
S132 Phosphorylation
T136 Phosphorylation
S144 Phosphorylation
T348 Phosphorylation
S356 Phosphorylation

Research Backgrounds

Function:

Ligand for members of the frizzled family of seven transmembrane receptors (Probable). Acts in the canonical Wnt signaling pathway by promoting beta-catenin-dependent transcriptional activation. In some developmental processes, is also a ligand for the coreceptor RYK, thus triggering Wnt signaling (By similarity). Plays an essential role in the development of the embryonic brain and central nervous system (CNS) (By similarity). Has a role in osteoblast function, bone development and bone homeostasis.

PTMs:

Palmitoleoylation is required for efficient binding to frizzled receptors. Palmitoleoylation is necessary for proper trafficking to cell surface (Probable). Depalmitoleoylated by NOTUM, leading to inhibit Wnt signaling pathway (By similarity).

Subcellular Location:

Secreted>Extracellular space>Extracellular matrix. Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Forms a soluble 1:1 complex with AFM; this prevents oligomerization and is required for prolonged biological activity. The complex with AFM may represent the physiological form in body fluids. Interacts with PORCN. Interacts with RSPO1, RSPO2 and RSPO3 (By similarity). Interacts with WLS (By similarity).

Family&Domains:

Belongs to the Wnt family.

Research Fields

· Cellular Processes > Cellular community - eukaryotes > Signaling pathways regulating pluripotency of stem cells.   (View pathway)

· Environmental Information Processing > Signal transduction > mTOR signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Wnt signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Hippo signaling pathway.   (View pathway)

· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.

· Human Diseases > Infectious diseases: Viral > HTLV-I infection.

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Overview > Proteoglycans in cancer.

· Human Diseases > Cancers: Specific types > Basal cell carcinoma.   (View pathway)

· Human Diseases > Cancers: Specific types > Breast cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Hepatocellular carcinoma.   (View pathway)

· Human Diseases > Cancers: Specific types > Gastric cancer.   (View pathway)

· Organismal Systems > Endocrine system > Melanogenesis.

References

1). Xu D et al. XQ-1H alleviates cerebral ischemia in mice through inhibition of apoptosis and promotion of neurogenesis in a Wnt/β-catenin signaling dependent way. Life Sci 2019 Sep 6;235:116844 (PubMed: 31499069) [IF=6.780]

2). Ma B et al. Yanghe Decoction Suppresses the Experimental Autoimmune Thyroiditis in Rats by Improving NLRP3 Inflammasome and Immune Dysregulation. Front Pharmacol 2021 Jun 21;12:645354. (PubMed: 34234669) [IF=5.810]

Application: WB    Species: Rat    Sample: peripheral blood mononuclear cell (PBMCs)

FIGURE 7 RT-PCR and Western blot analysis for the expression of molecules in the Wnt/β-catenin signaling pathway in peripheral blood mononuclear cell (PBMCs) (A) mRNA expression of Wnt-1 and β-catenin (B) Western blotting images of Wnt-1and β-catenin: Lane 1, control group; lane 2, model group; lane 3, YH 5 g crude drug/kG group; lane 4, YH 15 g crude drug/kG group; lane 5, selenious group (C) Bar graphs indicate the relative ratio of Wnt-1and β-catenin over tubulin. All values are expressed as mean ± SEM. *p < 0.05, **p < 0.01 vs Model.

3). Li X et al. Indoxyl sulfate promotes the atherosclerosis through up-regulating the miR-34a expression in endothelial cells and vascular smooth muscle cells in vitro. Vascul Pharmacol 2020 Jun 25;106763. (PubMed: 32593718) [IF=5.738]

Application: WB    Species: human    Sample: HUVECs and HA-VSMCs

Fig. 7.| IS inhibits the Notch signaling pathway and miR-34a-related protein. After transfection with miR-34a mimics (50 nM) or inhibitor (100 nM), IS (1000 μM) was added and incubated for another 36 h. Western blotting was used to detected the protein expression in HUVECs and HA-VSMCs. Data are represented as the mean ± SEM (n = 3). ⁎P < .05, versus control, #P < .05, versus IS group by one-way ANOVA with Tukey's test

4). Zhou J et al. Adipose derived mesenchymal stem cells alleviated osteoarthritis and chondrocyte apoptosis through autophagy inducing. J Cell Biochem 2018 Oct 13 (PubMed: 30315711) [IF=4.480]

5). Zhu Z et al. Chemokine (C-C motif) ligand 2-enhanced adipogenesis and angiogenesis of human adipose-derived stem cell and human umbilical vein endothelial cell co-culture system in adipose tissue engineering. J Tissue Eng Regen Med 2022 Feb;16(2):163-176. (PubMed: 34811942) [IF=4.323]

6). Tang H et al. Neoisoliquiritigenin Inhibits Tumor Progression by Targeting GRP78-β- catenin Signaling in Breast Cancer. Curr Cancer Drug Targets 2018;18(4):390-399 (PubMed: 28914191) [IF=2.907]

7). Xiaojun Li et al. Recombinant human irisin regulated collagen II, matrix metalloproteinase‑13 and the Wnt/β‑catenin and NF‑κB signaling pathways in interleukin‑1β‑induced human SW1353 cells. EXP THER MED 2020 Feb 26 [IF=2.751]

8). Li X et al. Recombinant human irisin regulated collagen II, matrix metalloproteinase‑13 and the Wnt/β‑catenin and NF‑κB signaling pathways in interleukin‑1β‑induced human SW1353 cells. Exp Ther Med 2020 Apr;19(4):2879-2886. (PubMed: 32256772) [IF=2.751]

Application: WB    Species: Human    Sample: SW1353 cells

Figure 4 Effect of irisin on the activation of the Wnt/β-catenin signaling pathway in IL-1β-induced SW1353 cells. SW1353 cells were treated with 20 mM irisin for 24 h, with or without IL-1β, and (A) β-catenin protein levels, (B) Wnt-1 protein levels and (C) β-catenin and Wnt-1 protein expression,were evaluated by western blot analysis. n=5/group. mRNA expression levels of (D) β-catenin and (E) Wnt-1 were evaluated by reverse transcription-quantitative PCR. n=5/group. *P<0.05, **P<0.01 and ***P<0.001. IL-1β, interleukin-1β; NC, negative control.

9). Zeng Y et al. HDAC1 regulates inflammation and osteogenic differentiation of ankylosing spondylitis fibroblasts through the Wnt-Smad signaling pathway. J Orthop Surg Res 2022 Jul 6;17(1):343. (PubMed: 35794630) [IF=2.677]

10). Tong Lu et al. Role of Wnt/β-catenin signaling pathway in the repair of intestinal mucosa associated with crypt stem cell in a rat model of abdominal compartment syndrome. Int J Clin Exp Pathol 2017;10(2):2351-2362 [IF=0.252]

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.