Product: Wnt1 Antibody
Catalog: AF5315
Description: Rabbit polyclonal antibody to Wnt1
Application: WB IHC IF/ICC
Cited expt.: WB, IHC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken
Mol.Wt.: 41 kDa(Observed); 41kD(Calculated).
Uniprot: P04628
RRID: AB_2837800

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%), Chicken(91%)
Clonality:
Polyclonal
Specificity:
Wnt1 Antibody detects endogenous levels of total Wnt1.
RRID:
AB_2837800
Cite Format: Affinity Biosciences Cat# AF5315, RRID:AB_2837800.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

BMND16; INT1; OI15; oncogene Int1; Proto oncogene protein Wnt 1; Proto-oncogene Int-1 homolog; Proto-oncogene Wnt-1; Wingless type MMTV integration site family member 1; wingless-type MMTV integration site family, member 1 (oncogene INT1); Wnt 1; wnt1; WNT1_HUMAN;

Immunogens

Immunogen:

A synthesized peptide derived from human Wnt1, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Description:
Ligand for members of the frizzled family of seven transmembrane receptors. In some developmental processes, is also a ligand for the coreceptor RYK, thus triggering Wnt signaling. Probable developmental protein. May be a signaling molecule important in CNS development. Is likely to signal over only few cell diameters.
Sequence:
MGLWALLPGWVSATLLLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPSLQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNCTHTRVLHECL

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Rabbit
100
Chicken
91
Zebrafish
55
Xenopus
45
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Ligand for members of the frizzled family of seven transmembrane receptors (Probable). Acts in the canonical Wnt signaling pathway by promoting beta-catenin-dependent transcriptional activation. In some developmental processes, is also a ligand for the coreceptor RYK, thus triggering Wnt signaling (By similarity). Plays an essential role in the development of the embryonic brain and central nervous system (CNS) (By similarity). Has a role in osteoblast function, bone development and bone homeostasis.

PTMs:

Palmitoleoylation is required for efficient binding to frizzled receptors. Palmitoleoylation is necessary for proper trafficking to cell surface (Probable). Depalmitoleoylated by NOTUM, leading to inhibit Wnt signaling pathway (By similarity).

Subcellular Location:

Secreted>Extracellular space>Extracellular matrix. Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the Wnt family.

Research Fields

· Cellular Processes > Cellular community - eukaryotes > Signaling pathways regulating pluripotency of stem cells.   (View pathway)

· Environmental Information Processing > Signal transduction > mTOR signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Wnt signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Hippo signaling pathway.   (View pathway)

· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.

· Human Diseases > Infectious diseases: Viral > HTLV-I infection.

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Overview > Proteoglycans in cancer.

· Human Diseases > Cancers: Specific types > Basal cell carcinoma.   (View pathway)

· Human Diseases > Cancers: Specific types > Breast cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Hepatocellular carcinoma.   (View pathway)

· Human Diseases > Cancers: Specific types > Gastric cancer.   (View pathway)

· Organismal Systems > Endocrine system > Melanogenesis.

References

1). Inhibition of the METTL3/m6A/miR-34a-5p axis suppresses trigeminovascular activation in nitroglycerin-induced migraine via the Wnt/β-catenin pathway. The journal of headache and pain, 2025 (PubMed: 41039196) [IF=7.3]

Application: WB    Species: Rat    Sample:

Fig. 5 METTL3 inactivated the Wnt1/β-catenin pathway through miR-34a-5p. (A) Wnt1 and β-catenin protein levels were measured in rat TG in sham, NTG, NTG + Ad-sh-NC, and NTG + Ad-sh-METTL3 groups. (B) Wnt1 and β-catenin protein levels were measured in rat trigeminal neurons in oe-NC, oe-METTL3, oe-METTL3 + antagomir NC, and oe-METTL3 + miR-34a-5p antagomir groups. n = 3 for both panels. Data are expressed as mean ± SD. Statistical analysis by one-way ANOVA followed by Tukey’s post hoc test.

2). Neuroprotective effects of oxymatrine on hypoxic-ischemic brain damage in neonatal rats by activating the Wnt/β-catenin pathway. Biomedicine & pharmacotherapy = Biomedecine & pharmacotherapie, 2023 (PubMed: 36652736) [IF=6.9]

Application: WB    Species: Rat    Sample: brain tissues

Fig. 4. Assessment of OMT on the protein expression levels of DKK1, Wnt1, Dvl2, Axin1, APC, GSK-3β, p-GSK-3β, β-catenin, and the binding affinity between β-catenin with Tcf-4 in the ischemic brain tissues following HI insult. Representative Western blotting bands and quantitative analyses depicted the DKK1 (A), Wnt1 (B), Dvl2 (C), Axin1 (D), APC (E), GSK-3β (F), p-GSK-3β (G), and β-catenin (H) protein expression (n = 6 per group). (I) Representative immunofluorescent-stained images of β-catenin in the ipsilateral brain regions at 48 h after HI. (J) Quantitative analysis of β-catenin immunopositive cells. (K) An EMSA image of the binding affinity between β-catenin with Tcf-4. Data are expressed as the mean ± SD (n = 6). ##P 

3). Anemarrhena asphodeloides-derived small extracellular vesicle ameliorate diabetes-induced muscle atrophy via activating Pink1-mediated mitophagy. Phytomedicine : international journal of phytotherapy and phytopharmacology, 2025 (PubMed: 41308393) [IF=6.7]

4). Yanghe Decoction Suppresses the Experimental Autoimmune Thyroiditis in Rats by Improving NLRP3 Inflammasome and Immune Dysregulation. Frontiers in Pharmacology, 2021 (PubMed: 34234669) [IF=5.6]

Application: WB    Species: Rat    Sample: peripheral blood mononuclear cell (PBMCs)

FIGURE 7 RT-PCR and Western blot analysis for the expression of molecules in the Wnt/β-catenin signaling pathway in peripheral blood mononuclear cell (PBMCs) (A) mRNA expression of Wnt-1 and β-catenin (B) Western blotting images of Wnt-1and β-catenin: Lane 1, control group; lane 2, model group; lane 3, YH 5 g crude drug/kG group; lane 4, YH 15 g crude drug/kG group; lane 5, selenious group (C) Bar graphs indicate the relative ratio of Wnt-1and β-catenin over tubulin. All values are expressed as mean ± SEM. *p < 0.05, **p < 0.01 vs Model.

5). XQ-1H alleviates cerebral ischemia in mice through inhibition of apoptosis and promotion of neurogenesis in a Wnt/β-catenin signaling dependent way. LIFE SCIENCES, 2019 (PubMed: 31499069) [IF=5.2]

6). Phillygenin Inhibits TGF-β1-induced Hepatic Stellate Cell Activation and Inflammation: Regulation of the Bax/Bcl-2 and Wnt/β-catenin Pathways. Inflammation, 2024 (PubMed: 38393550) [IF=4.5]

Application: WB    Species: Mouse    Sample: mHSC

Fig. 10 Efects of PHI on Wnt/β-catenin signaling pathway-related proteins. a Western blotting analyses of Wnt1, β-catenin, GSK-3β, p-GSK-3β, c-Myc, and Cyclin D1 in mHSCs.

7). Absence of the Klotho Function Causes Cornea Degeneration with Specific Features Resembling Fuchs Endothelial Corneal Dystrophy and Bullous Keratopathy. Biology, 2024 (PubMed: 38534403) [IF=4.2]

Application: IHC    Species: Human    Sample:

Figure 6. Representative photographs of corneal immunohistochemical detection with Wnt1 antibody and quantification analysis. (A) Wnt1 immunodetection in a male cornea. (B) Wnt1 immunodetection in a female cornea. (C–E) For the quantitative analysis, the Wnt1 expression is presented as a Wnt1-positive area/central cornea area, peripheral cornea area, and limbus area in Figures (C–E), respectively. Wnt-1 expression increases with the Klotho null mutation in both genders, although without statistical significance (C,D). In the limbus, Wnt-1 expression also increases in the male Klotho null mutants. In the limbus of the female mutants, a significant decrease in Wnt-1 expression can be seen when compared with the Klotho heterozygous mutants (E). * p < 0.05. Scale bars represent 25 μm.

8). Regulation of endoplasmic reticulum stress and liver injury by hydroxysafflor yellow a through mir-222-3p-pten-wnt axis. European journal of pharmacology, 2025 (PubMed: 40675360) [IF=4.2]

9). Tangshen Formula Improves Diabetes-Associated Myocardial Fibrosis by Inhibiting TGF-β/Smads and Wnt/β-Catenin Pathways. Frontiers in Medicine, 2021 (PubMed: 34938743) [IF=3.9]

Application: WB    Species: Mouse    Sample:

Figure 4 An effect of TSF on the canonical Wnt pathway. (A) IHC of anti-β-catenin (original magnification, 200×). Data are presented as mean ± SEM. *p < 0.05, **p < 0.01 TSF-treated group vs. KKAy group; #p < 0.05, ##p < 0.01, ###p < 0.001 KKAy group vs. C57BL/6J group. (B) Western blot analyses and semi-quantitative analyses revealed expressions of Wnt1, active-β-catenin, β-catenin, FN, and MMP-7 in KKAy mice and the different treatment groups. #p < 0.05, ##p < 0.01, ###p < 0.001, ####p < 0.0001 KKAy group vs. C57BL/6J group. *p < 0.05, **p < 0.01 TSF-treated group vs. KKAy group.

10). Indoxyl sulfate promotes the atherosclerosis through up-regulating the miR-34a expression in endothelial cells and vascular smooth muscle cells in vitro. VASCULAR PHARMACOLOGY, 2020 (PubMed: 32593718) [IF=3.5]

Application: WB    Species: human    Sample: HUVECs and HA-VSMCs

Fig. 7.| IS inhibits the Notch signaling pathway and miR-34a-related protein. After transfection with miR-34a mimics (50 nM) or inhibitor (100 nM), IS (1000 μM) was added and incubated for another 36 h. Western blotting was used to detected the protein expression in HUVECs and HA-VSMCs. Data are represented as the mean ± SEM (n = 3). ⁎P < .05, versus control, #P < .05, versus IS group by one-way ANOVA with Tukey's test

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.