Product: HO-1 Antibody
Catalog: DF6391
Description: Rabbit polyclonal antibody to HO-1
Application: WB IHC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 33kDa; 33kD(Calculated).
Uniprot: P09601
RRID: AB_2838354

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
HO-1 Antibody detects endogenous levels of total HO-1.
RRID:
AB_2838354
Cite Format: Affinity Biosciences Cat# DF6391, RRID:AB_2838354.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

32 kD; bK286B10; D8Wsu38e; heat shock protein 32 kD; heat shock protein 32kD; Heat shock protein; Heme oxygenase (decycling) 1; Heme oxygenase 1; Hemox; HMOX 1; Hmox; Hmox1; HMOX1_HUMAN; HO 1; HO; HO-1; HO1; Hsp32;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
P09601 HMOX1_HUMAN:

Expressed at higher levels in renal cancer tissue than in normal tissue (at protein level).

Description:
Hemeoxygenase (HO) is the rate-limiting enzyme in the catabolism of heme that results in the release of carbon monoxide, iron, and biliverdin (1). The products of this enzymatic reaction play important biological roles in antioxidant, anti-inflammatory and cytoprotective functions (2). Hemeoxygenase comprises two isozymes, including the constitutively expressed HO-2 isozyme and the inducible HO-1 isozyme (3). Inducible HO-1 is expressed as an adaptive response to several stimuli, including heme, metals, and hormones (4). The induction of HO-1 has been implicated in numerous disease states, such as transplant rejection, hypertension, atherosclerosis, Alzheimer disease, endotoxic shock, diabetes, inflammation, and neurological disorders (1,5).
Sequence:
MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM

PTMs - P09601 As Substrate

Site PTM Type Enzyme
K18 Acetylation
K18 Ubiquitination
K22 Ubiquitination
K39 Acetylation
K39 Ubiquitination
S53 Phosphorylation
Y55 Phosphorylation
Y58 Phosphorylation
K69 Ubiquitination
K86 Ubiquitination
T108 Phosphorylation
Y114 Phosphorylation
Y137 Phosphorylation
K148 Ubiquitination
K149 Ubiquitination
K153 Ubiquitination
S160 Phosphorylation
K177 Ubiquitination
K179 Ubiquitination
S188 Phosphorylation P31749 (AKT1)
T192 Phosphorylation
S229 Phosphorylation
S231 Phosphorylation
K243 Acetylation
K243 Ubiquitination
T252 Phosphorylation
K256 Acetylation
K256 Ubiquitination
Y286 Phosphorylation

Research Backgrounds

Function:

Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. Exhibits cytoprotective effects since excess of free heme sensitizes cells to undergo apoptosis.

Subcellular Location:

Microsome. Endoplasmic reticulum membrane>Peripheral membrane protein>Cytoplasmic side.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed at higher levels in renal cancer tissue than in normal tissue (at protein level).

Family&Domains:

Belongs to the heme oxygenase family.

Research Fields

· Cellular Processes > Cell growth and death > Ferroptosis.   (View pathway)

· Environmental Information Processing > Signal transduction > HIF-1 signaling pathway.   (View pathway)

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Overview > MicroRNAs in cancer.

· Human Diseases > Cancers: Specific types > Hepatocellular carcinoma.   (View pathway)

· Metabolism > Metabolism of cofactors and vitamins > Porphyrin and chlorophyll metabolism.

· Metabolism > Global and overview maps > Metabolic pathways.

· Organismal Systems > Digestive system > Mineral absorption.

References

1). Tetrahydrocurcumin protects against nonalcoholic fatty liver disease by improving lipid metabolism and redox homeostasis. Journal of Functional Foods, 2022 [IF=3.8]

Application: WB    Species: Human    Sample: HepG2 cells

Fig. 6. Effect of tetrahydrocurcumin (THC) on lipid content and expression of the NRF2 pathway in HepG2 cells. HepG2 cells were treated with 0.2 mM sodium oleate (OA) for 24 h, and then with THC for 48 h. Oil red O was used to determine the (A) Intracellular lipid content. RT-qPCR and Western blot were used to analyze the expression of NRF2 signaling pathway. (B) Relative expression of NRF2, NQO1 and HO-1 mRNA; (C) Relative expression of GSTA1, GCLC and GCLM mRNA; (D) Relative expression of NRF2 protein; (E) Relative expression of NQO1 protein; (F) Relative expression of HO-1 protein. Different letters (a-d) between groups indicate significant differences

2). Attenuation of blue light-induced photo-oxidative stress through inhibition of NF-κB and MAPK signaling pathways, and activation of Nrf2 signaling pathway by djulis and its bioactive compounds. Journal of Functional Foods, 2023 [IF=3.8]

3). 紅藜與其活性成分對LED光源誘發視網膜傷害之保護效應. 計畫編號:MOST110-2320-B041-001-MY2, 2022

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.