Product: Fas Ligand Antibody
Catalog: AF0157
Description: Rabbit polyclonal antibody to Fas Ligand
Application: WB IHC IF/ICC
Cited expt.: WB
Reactivity: Human, Mouse
Prediction: Pig, Horse, Dog
Mol.Wt.: 33kDa(Observed); 31kD(Calculated).
Uniprot: P48023
RRID: AB_2833338

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:3000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Prediction:
Pig(100%), Horse(88%), Dog(88%)
Clonality:
Polyclonal
Specificity:
Fas Ligand Antibody detects endogenous levels of total Fas Ligand.
RRID:
AB_2833338
Cite Format: Affinity Biosciences Cat# AF0157, RRID:AB_2833338.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

ALPS1B; Apoptosis (APO 1) antigen ligand 1; Apoptosis antigen ligand 1; Apoptosis antigen ligand; APT1LG1; APTL; CD178; CD178 antigen; CD95 ligand; CD95-L; CD95L; CD95L protein; Fas antigen ligand; Fas L; Fas ligand (TNF superfamily member 6); Fas ligand; FASL; Fasl Fas ligand (TNF superfamily member 6); FASLG; Generalized lymphoproliferative disease; Gld; soluble form; TNFL6_HUMAN; TNFSF6; Tumor necrosis factor (ligand) superfamily member 6; Tumor necrosis factor ligand superfamily member 6;

Immunogens

Immunogen:

A synthesized peptide derived from human Fas Ligand, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Description:
FasL Cytokine that binds to TNFRSF6/FAS, a receptor that transduces the apoptotic signal into cells. May be involved in cytotoxic T-cell mediated apoptosis and in T-cell development. TNFRSF6/FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. Binding to the decoy receptor TNFRSF6B/DcR3 modulates its effects.
Sequence:
MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
88
Dog
88
Bovine
75
Sheep
75
Rabbit
75
Xenopus
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Cytokine that binds to TNFRSF6/FAS, a receptor that transduces the apoptotic signal into cells. Involved in cytotoxic T-cell-mediated apoptosis, natural killer cell-mediated apoptosis and in T-cell development. Initiates fratricidal/suicidal activation-induced cell death (AICD) in antigen-activated T-cells contributing to the termination of immune responses (By similarity). TNFRSF6/FAS-mediated apoptosis has also a role in the induction of peripheral tolerance (By similarity). Binds to TNFRSF6B/DcR3, a decoy receptor that blocks apoptosis.

Induces FAS-mediated activation of NF-kappa-B, initiating non-apoptotic signaling pathways (By similarity). Can induce apoptosis but does not appear to be essential for this process.

Cytoplasmic form induces gene transcription inhibition.

PTMs:

The soluble form derives from the membrane form by proteolytic processing. The membrane-bound form undergoes two successive intramembrane proteolytic cleavages. The first one is processed by ADAM10 producing an N-terminal fragment, which lacks the receptor-binding extracellular domain. This ADAM10-processed FasL (FasL APL) remnant form is still membrane anchored and further processed by SPPL2A that liberates the FasL intracellular domain (FasL ICD). FasL shedding by ADAM10 is a prerequisite for subsequent intramembrane cleavage by SPPL2A in T-cells.

N-glycosylated. Glycosylation enhances apoptotic activity.

Phosphorylated by FGR on tyrosine residues; this is required for ubiquitination and subsequent internalization.

Monoubiquitinated.

Subcellular Location:

Cell membrane>Single-pass type II membrane protein. Cytoplasmic vesicle lumen. Lysosome lumen.
Note: Is internalized into multivesicular bodies of secretory lysosomes after phosphorylation by FGR and monoubiquitination (PubMed:17164290). Colocalizes with the SPPL2A protease at the cell membrane (PubMed:17557115).

Secreted.
Note: May be released into the extracellular fluid by cleavage from the cell surface.

Nucleus.
Note: The FasL ICD cytoplasmic form is translocated into the nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the tumor necrosis factor family.

Research Fields

· Cellular Processes > Cell growth and death > Apoptosis.   (View pathway)

· Cellular Processes > Cell growth and death > Necroptosis.   (View pathway)

· Environmental Information Processing > Signal transduction > MAPK signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Ras signaling pathway.   (View pathway)

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.   (View pathway)

· Environmental Information Processing > Signal transduction > FoxO signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway.   (View pathway)

· Human Diseases > Drug resistance: Antineoplastic > Platinum drug resistance.

· Human Diseases > Endocrine and metabolic diseases > Non-alcoholic fatty liver disease (NAFLD).

· Human Diseases > Endocrine and metabolic diseases > Type I diabetes mellitus.

· Human Diseases > Infectious diseases: Parasitic > Chagas disease (American trypanosomiasis).

· Human Diseases > Infectious diseases: Parasitic > African trypanosomiasis.

· Human Diseases > Infectious diseases: Viral > Hepatitis B.

· Human Diseases > Infectious diseases: Viral > Measles.

· Human Diseases > Infectious diseases: Viral > Influenza A.

· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.

· Human Diseases > Infectious diseases: Viral > Herpes simplex infection.

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Overview > Proteoglycans in cancer.

· Human Diseases > Immune diseases > Autoimmune thyroid disease.

· Human Diseases > Immune diseases > Allograft rejection.

· Human Diseases > Immune diseases > Graft-versus-host disease.

· Organismal Systems > Immune system > Natural killer cell mediated cytotoxicity.   (View pathway)

· Organismal Systems > Nervous system > Neurotrophin signaling pathway.   (View pathway)

References

1). Sulforaphane activates CD8+ T cells antitumor response through IL-12RB2/MMP3/FasL-induced MDSCs apoptosis'. Journal for immunotherapy of cancer, 2024 (PubMed: 38296593) [IF=10.9]

Application: WB    Species: Mouse    Sample: MDSCs

Figure 5. MMP3/FasL was the downstream of SFN-activated IL-12RB2 in MDSCs. (A) The relative expressions of MMP3 and MMP7 in bone marrow induced MDSCs with or without SFN, based on RNA sequencing data. (B) qRT-PCR was performed to examine the expression of MMP3 from MDSCs with or without SFN treatment in vivo and in vitro. (C) qRT-PCR was performed to examine the expression of FasL from MDSCs with or without SFN treatment in vivo and in vitro. (D) Western blotting and qRT-PCR were performed to examine MMP3 and FasL in MDSCs treated with SFN, anti-IL-12RB2, or SFN+anti-IL-12RB2. (E) Flow analysis of MDSCs percentages and apoptotic rates following SFN, anti-IL-12RB2, and SFN+anti-IL-12RB2 treatment. (F) Flow analysis of cleaved caspase-3+MDSCs percentages following SFN, anti-IL-12RB2, or SFN+anti-IL-12RB2 treatment. (G) Western blotting was performed to analyze caspase-3 expression in MDSCs treated with SFN, anti-IL-12RB2, or SFN+anti-IL-12RB2. (H) Flow analysis of FasL+ and cleaved caspase-3+MDSCs following SFN, anti-IL-12RB2, or SFN+anti-IL-12RB2 treatment. (I) Western blotting was performed to examine caspase-3 expression in MDSCs treated with SFN, anti-FasL, or SFN+anti FasL. (J) Immunohistochemistry analysis of MMP3 and FasL in tumor samples from LLC mice treated with SFN, anti-IL-12RB2, or SFN+anti-IL-12RB2. Data were presented as the mean±SEM. ns, not significant, *p

2). Effects of Bisphenol A on reproductive toxicity and gut microbiota dysbiosis in male rats. Ecotoxicology and Environmental Safety, 2022 (PubMed: 35567931) [IF=6.2]

Application: WB    Species: Rat    Sample: testes tissue

Fig. 4. Effects of BPA exposure on cell apoptosis in testes. (A) Western blotting photographs and relative quantitative analysis of (B) Cleaved-PARP and PARP protein, (C) FASL, (D) FAS, (E) Cleaved-caspase3, (F) Caspase3, (G) Bcl-2, (H) Bax, and (I) Bcl-2/Bax. Data are expressed as mean ± SD (n = 4). Different letters indicate significant differences between groups (P 

3). Immunosensitivity mediated by downregulated AKT1-SKP2 induces anti-PD-1-associated thyroid immune injury. International immunopharmacology, 2023 (PubMed: 37302368) [IF=4.8]

Application: WB    Species: human    Sample:

ig. 4. The downstream regulation of AKT1 in NIVO-treated NTHY cells.

4). Inhibition of microRNA-327 ameliorates ischemia/reperfusion injury-induced cardiomyocytes apoptosis through targeting apoptosis repressor with caspase recruitment domain. JOURNAL OF CELLULAR PHYSIOLOGY, 2020 (PubMed: 31587299) [IF=4.5]

Application: WB    Species:    Sample: heart

FIGURE 7| Inhibition of miR‐327 suppressed I/R‐induced extrinsic and intrinsic apoptosis‐associated molecules expression. Caspase‐8, Fas and FasL protein expression was detected in heart tissues of MI/RI rats by western blot (a). Quantitative analysis of Caspase‐8 (b), Fas (c), and FasL(d) expression was shown in Bar graphs.Caspase‐9, Bax, Bcl‐2, and Cyt‐c proteinexpression was detected in heart tissues of MI/RI rats by Western blot (e).

5). Qingfei mixture modulates the immune responses in lung cancer through modulating mTOR signaling and gut microbiota-derived short-chain fatty acids. Heliyon, 2024 (PubMed: 38660245) [IF=4.0]

6). The anticancer mechanisms of exopolysaccharide from Weissella cibaria D-2 on colorectal cancer via apoptosis induction. Scientific reports, 2023 (PubMed: 38036594) [IF=3.8]

7). PD-1 inhibitor induces myocarditis by reducing regulatory T cells, activating inflammatory responses, promoting myocardial apoptosis and autophagy. CYTOKINE, 2022 (PubMed: 35691121) [IF=3.7]

8). Akkermansia muciniphila Enhances the Antitumor Effect of Cisplatin in Lewis Lung Cancer Mice. Journal of immunology research, 2020 (PubMed: 32832569) [IF=3.5]

Application: WB    Species: Mouse    Sample: lung cancer

Figure 6 Effect of CDDP combined with Akk on ki-67, p53, Fas, and FasL protein expression in lung cancer mice. The levels of ki-67, p53, Fas, and FasL proteins from tumor tissues were detected by western blot and normalized to GAPDH (a), and then relative band intensities were used in order to quantify ki-67, p53, Fas, and FasL proteins (b). Data were presented as the mean ± SD, n = 6 in each group.▲▲P < 0.01 versus the model group; #P < 0.05, ##P < 0.01 versus the CDDP group.

9). EGFR‑associated pathways involved in traditional Chinese medicine (TCM)‑1‑induced cell growth inhibition, autophagy and apoptosis in prostate cancer. Molecular Medicine Reports, 2018 (PubMed: 29620175) [IF=3.4]

Application: WB    Species: human    Sample: LNCaP cells

Figure 4.| TCM‑1 induces the activation of the intrinsic and extrinsic apoptotic pathways in a p53‑independent manner in LNCaP and PC3 cells. (A) LNCaP and (B) PC3 cells were incubated overnight and treated with different concentrations of TCM‑1 (0, 2, 5 and 10 mg/ml) for 24 h. The cells were harvested for western blot analysis to assess the protein levels of Bim, Fas‑L and β‑actin (loading control).

10). Traditional Chinese Medicine CFF-1 induced cell growth inhibition, autophagy, and apoptosis via inhibiting EGFR-related pathways in prostate cancer. Cancer Medicine, 2018 (PubMed: 29533017) [IF=2.9]

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.