COX7A2L Antibody - #DF10094
| Product: | COX7A2L Antibody |
| Catalog: | DF10094 |
| Description: | Rabbit polyclonal antibody to COX7A2L |
| Application: | WB |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Dog |
| Mol.Wt.: | 13 kDa; 13kD(Calculated). |
| Uniprot: | O14548 |
| RRID: | AB_2840674 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF10094, RRID:AB_2840674.
Fold/Unfold
COX7a related protein; COX7a-related protein; COX7A2L; COX7AR; COX7R_HUMAN; COX7RP; Cytochrome c oxidase subunit 7A-related protein; cytochrome c oxidase subunit 7A-related protein, mitochondrial; cytochrome c oxidase subunit VII-related protein; cytochrome c oxidase subunit VIIa polypeptide 2 like; Cytochrome c oxidase subunit VIIa related protein, mitochondrial; Cytochrome c oxidase subunit VIIa-related protein; EB1; Estrogen receptor binding CpG island; mitochondrial; SIG81;
Immunogens
A synthesized peptide derived from human COX7A2L, corresponding to a region within the internal amino acids.
- O14548 COX7R_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Involved in the regulation of oxidative phosphorylation and energy metabolism (By similarity). Necessary for the assembly of mitochondrial respiratory supercomplex (By similarity).
Mitochondrion inner membrane.
Belongs to the cytochrome c oxidase VIIa family.
Research Fields
· Human Diseases > Endocrine and metabolic diseases > Non-alcoholic fatty liver disease (NAFLD).
· Human Diseases > Neurodegenerative diseases > Alzheimer's disease.
· Human Diseases > Neurodegenerative diseases > Parkinson's disease.
· Human Diseases > Neurodegenerative diseases > Huntington's disease.
· Metabolism > Energy metabolism > Oxidative phosphorylation.
· Organismal Systems > Circulatory system > Cardiac muscle contraction. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.