ATP5D Antibody - #DF12845
| Product: | ATP5D Antibody |
| Catalog: | DF12845 |
| Description: | Rabbit polyclonal antibody to ATP5D |
| Application: | |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Chicken |
| Mol.Wt.: | 17 kDa(Observed); 17kD(Calculated). |
| Uniprot: | P30049 |
| RRID: | AB_2845806 |
Control Products
Related Downloads
Protocols
Product Info
Cite Format: Affinity Biosciences Cat# DF12845, RRID:AB_2845806.
Fold/Unfold
ATP synthase subunit delta, mitochondrial; ATP synthase subunit delta, mitochondrial; ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit; ATP5D; ATPD_HUMAN; F ATPase delta subunit; F-ATPase delta subunit; Mitochondrial ATP synthase complex delta subunit precusor; Mitochondrial ATP synthase delta subunit;
Immunogens
A synthesized peptide derived from human ATP5D, corresponding to a region within the internal amino acids.
- P30049 ATPD_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLPAALLRRPGLGRLVRHARAYAEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANEALVKALE
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP turnover in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(1) domain and of the central stalk which is part of the complex rotary element. Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits.
Mitochondrion. Mitochondrion inner membrane.
Belongs to the ATPase epsilon chain family.
Research Fields
· Human Diseases > Neurodegenerative diseases > Alzheimer's disease.
· Human Diseases > Neurodegenerative diseases > Parkinson's disease.
· Human Diseases > Neurodegenerative diseases > Huntington's disease.
· Metabolism > Energy metabolism > Oxidative phosphorylation.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.