Product: ELK1 Antibody
Catalog: AF6212
Description: Rabbit polyclonal antibody to ELK1
Application: WB IHC IF/ICC IP
Cited expt.: WB, IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog, Xenopus
Mol.Wt.: 62kDa(Observed); 45kD(Calculated).
Uniprot: P19419
RRID: AB_2835093

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IP, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%), Xenopus(100%)
Clonality:
Polyclonal
Specificity:
ELK1 Antibody detects endogenous levels of total ELK1.
RRID:
AB_2835093
Cite Format: Affinity Biosciences Cat# AF6212, RRID:AB_2835093.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

ELK 1; Elk1; ELK1 member of ETS oncogene family; ELK1 protein; ELK1, ETS transcription factor; ELK1_HUMAN; ELK2 member of ETS oncogene family; ETS domain containing protein Elk 1; ETS domain containing protein Elk1; ETS domain protein Elk1; ETS domain-containing protein Elk-1; ETS like gene 1; Member of ETS oncogene family; Oncogene Elk1; Tyrosine kinase (ELK1) oncogene;

Immunogens

Immunogen:

A synthesized peptide derived from human ELK1, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
P19419 ELK1_HUMAN:

Lung and testis.

Description:
This gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum reponse element in the promoter of the c-fos proto-oncogene.
Sequence:
MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSTMPNVAPAAIHAAPGDTVSGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQSLQPQPPPHPRPAVVLPSAAPAGAAAPPSGSRSTSPSPLEACLEAEEAGLPLQVILTPPEAPNLKSEELNVEPGLGRALPPEVKVEGPKEELEVAGERGFVPETTKAEPEVPPQEGVPARLPAVVMDTAGQAGGHAASSPEISQPQKGRKPRDLELPLSPSLLGGPGPERTPGSGSGSGLQAPGPALTPSLLPTHTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVVLSPGPQKP

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Xenopus
100
Rabbit
100
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Transcription factor that binds to purine-rich DNA sequences. Forms a ternary complex with SRF and the ETS and SRF motifs of the serum response element (SRE) on the promoter region of immediate early genes such as FOS and IER2. Induces target gene transcription upon JNK-signaling pathway stimulation (By similarity).

PTMs:

Sumoylation represses transcriptional activator activity as it results in recruitment of HDAC2 to target gene promoters which leads to decreased histone acetylation and reduced transactivator activity. It also regulates nuclear retention.

On mitogenic stimulation, phosphorylated on C-terminal serine and threonine residues by MAPK1. Ser-383 and Ser-389 are the preferred sites for MAPK1. In vitro, phosphorylation by MAPK1 potentiates ternary complex formation with the serum responses factors, SRE and SRF. Also phosphorylated on Ser-383 by MAPK8 and/or MAKP9. Phosphorylation leads to loss of sumoylation and restores transcriptional activator activity. Phosphorylated and activated by CAMK4, MAPK11, MAPK12 and MAPK14. Upon bFGF stimulus, phosphorylated by PAK1 (By similarity).

Subcellular Location:

Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Lung and testis.

Family&Domains:

Belongs to the ETS family.

Research Fields

· Cellular Processes > Cellular community - eukaryotes > Focal adhesion.   (View pathway)

· Environmental Information Processing > Signal transduction > MAPK signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > ErbB signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Ras signaling pathway.   (View pathway)

· Human Diseases > Neurodegenerative diseases > Prion diseases.

· Human Diseases > Infectious diseases: Parasitic > Leishmaniasis.

· Human Diseases > Infectious diseases: Viral > Hepatitis B.

· Human Diseases > Infectious diseases: Viral > HTLV-I infection.

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Overview > Proteoglycans in cancer.

· Human Diseases > Cancers: Specific types > Endometrial cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Hepatocellular carcinoma.   (View pathway)

· Organismal Systems > Endocrine system > Insulin signaling pathway.   (View pathway)

· Organismal Systems > Endocrine system > Oxytocin signaling pathway.

References

1). Dissecting the process of human neutrophil lineage determination by using alpha-lipoic acid inducing neutrophil deficiency model. Redox biology, 2022 (PubMed: 35797799) [IF=10.7]

Application: IF/ICC    Species: human    Sample:

Fig. 5. ALA regulates commitment of neutrophil progenitors by targeting ELK1. (A) Statistical analysis of neutrophils and monocytes differentiated from NbP1s, NbP2s, and NbP3s ± ALA treatment. To analyze the effect of ALA on neutrophil differentiation, sorted neutrophil biased progenitors were cultured ± ALA and flow cytometry assay to performed to analyze the CD11b+CD15+CD66b+CD14– neutrophils and CD11b+ CD66b–CD14+ monocytes at day6 to day14.

2). Small-molecule α-lipoic acid targets ELK1 to balance human neutrophil and erythrocyte differentiation. Stem cell research & therapy, 2024 (PubMed: 38589882) [IF=7.5]

3). Protective effect of remdesivir against pulmonary fibrosis in mice. Frontiers in Pharmacology, 2021 (PubMed: 34512328) [IF=5.6]

Application: WB    Species: Mice    Sample: lung tissues

FIGURE 10 Remdesivir suppress BLM-induced pulmonary fibrosis in mice via inhibiting TGF-β1-Smad and non-Smad signaling pathway in vivo. Protein levels of p-Smad2, Smad2, p-Smad3, Smad3, p-P38, P38, p-JNK, JNK, p-ERK, ERK, p-AKT, and AKT were verified by Western blot in lung tissues. GAPDH was used as an internal reference in densitometric analysis. Data was presented as the means ± SD, n = 3. ** p < 0.01, *** p < 0.001.

4). LncRNA 122049 suppresses apoptosis of renal tubular epithelial cells in ischemic AKI by targeting the miR‐330‐5p/ELK1 axis. The FASEB Journal, 2022 (PubMed: 35695811) [IF=4.4]

Application: WB    Species: Mice    Sample: BUMPT cells

FIGURE 6ELK1 was identified as a target gene of miR-330-5p and mediated the renal cell apoptosis. BUMPT cells were transfected with 100 nM miR-330-5p mimics or ELK1 siRNA or scramble and then treated with or without 2 h ischemia and 2 h reperfusion. (A) Putative miR-330-5p complementary binding sites in the 3′ UTR of ELK1 mRNA. (B) The examination of luciferase activities after co-transfection with the 3′ UTR luciferase reporter vector of WT- or MUT-ELK1 and miR-330-5p mimic or miR-negative control (NC). (C and D) Real-time qPCR and western blot analysis of ELK1 and β-Tubulin. (E) The FCM detection of BUMPT cells apoptosis. (F) The representative of apoptosis rate. (G) Immunoblot analysis of cleaved caspase-3 and caspase-3. (H) Densitometric measurement of immunoblot bands. Data are expressed as mean ± SD (n = 6). #p < .05, versus scramble with saline group; *p < .05, versus scramble with I/R group or ELK1 3′ UTR WT plus miR-330-5p mimics versus other groups.

5). ANXA3 interference inactivates ERK/ELK1 pathway to mitigate inflammation and apoptosis in sepsis-associated acute lung injury. Molecular immunology, 2024 (PubMed: 38310670) [IF=3.2]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.