Product: GADD45A Antibody
Catalog: DF6622
Description: Rabbit polyclonal antibody to GADD45A
Application: WB IHC IF/ICC
Cited expt.: WB
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Sheep, Rabbit, Dog
Mol.Wt.: 18kDa; 18kD(Calculated).
Uniprot: P24522
RRID: AB_2838584

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(100%), Sheep(100%), Rabbit(100%), Dog(100%)
Clonality:
Polyclonal
Specificity:
GADD45A Antibody detects endogenous levels of total GADD45A.
RRID:
AB_2838584
Cite Format: Affinity Biosciences Cat# DF6622, RRID:AB_2838584.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

DDIT 1; DDIT-1; DDIT1; DNA damage inducible transcript 1; DNA damage-inducible transcript 1 protein; GA45A_HUMAN; GADD45; GADD45A; Growth arrest and DNA damage inducible 45 alpha; Growth arrest and DNA damage inducible alpha; Growth arrest and DNA damage-inducible protein GADD45 alpha;

Immunogens

Immunogen:

A synthesized peptide derived from human GADD45A, corresponding to a region within N-terminal amino acids.

Uniprot:
Gene(ID):
Description:
This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The DNA damage-induced transcription of this gene is mediated by both p53-dependent and -independent mechanisms. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Sequence:
MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Bovine
100
Sheep
100
Dog
100
Rabbit
100
Xenopus
64
Horse
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

In T-cells, functions as a regulator of p38 MAPKs by inhibiting p88 phosphorylation and activity (By similarity). Might affect PCNA interaction with some CDK (cell division protein kinase) complexes; stimulates DNA excision repair in vitro and inhibits entry of cells into S phase.

Subcellular Location:

Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the GADD45 family.

Research Fields

· Cellular Processes > Cell growth and death > Cell cycle.   (View pathway)

· Cellular Processes > Cell growth and death > p53 signaling pathway.   (View pathway)

· Cellular Processes > Cell growth and death > Apoptosis.   (View pathway)

· Cellular Processes > Cell growth and death > Cellular senescence.   (View pathway)

· Environmental Information Processing > Signal transduction > MAPK signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > FoxO signaling pathway.   (View pathway)

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.

· Human Diseases > Cancers: Specific types > Colorectal cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Pancreatic cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Endometrial cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Glioma.   (View pathway)

· Human Diseases > Cancers: Specific types > Thyroid cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Basal cell carcinoma.   (View pathway)

· Human Diseases > Cancers: Specific types > Melanoma.   (View pathway)

· Human Diseases > Cancers: Specific types > Chronic myeloid leukemia.   (View pathway)

· Human Diseases > Cancers: Specific types > Small cell lung cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Non-small cell lung cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Breast cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Hepatocellular carcinoma.   (View pathway)

· Human Diseases > Cancers: Specific types > Gastric cancer.   (View pathway)

References

1). PXD101 inhibits malignant progression and radioresistance of glioblastoma by upregulating GADD45A. Journal of translational medicine, 2024 (PubMed: 39568000) [IF=7.4]

Application: WB    Species: Human    Sample: T98G cells and LN229 cells

Fig. 2. PXD101 induces the expression of GADD45A. T98G cells and LN229 cells were treated with PXD101 (5µM, 1µM) for 24 h, respectively. (A) qPCR array analyses of 55 tumor suppressor genes in GBM cells are displayed using a heatmap. (B) The mRNA expressions of DKK1, MXI1, GADD45B, NF2, DAPK3, ING1, TNF10A, FOXO6, PTEN, GADD45A, RASSF4, TP63, and FOXO1 were detected using qPCR. (C) The protein expressions of NF2, GADD45A, and FOXO1 were analyzed using Western blot. (D) LN229 cells were treated with PXD101 (1µM) for 24 h, 48 h, and 72 h, respectively, and T98G cells were treated with PXD101 (5µM) for 48 h. The GADD45A expression was detected using Western blot. (E-F) The mRNA and protein expressions of GADD45A were detected using qPCR (E) and Western blot (F) in the normal glial cells HEB and glioma cells. Data are shown as the mean ± SD of three independent experiments. *P 

2). Hexavalent chromium caused DNA damage repair and apoptosis via the PI3K/AKT/FOXO1 pathway triggered by oxidative stress in the lung of rat. Ecotoxicology and environmental safety, 2023 (PubMed: 37890257) [IF=6.2]

Application: WB    Species: Rat    Sample: lung

Fig. 5. Effects of Cr(VI) on the protein expressions of DNA damage repair. (A)The represented protein bands of GADD45a, XRCC1, and CHK2 in the lung of rats. (B-D) The relative gray values of GADD45a, XRCC1, and CHK2 in the lung of rats. N ≥ 3. Compared with the control group in the same group, *, p 

3). Activation of the MEK/ERK Pathway Mediates the Inhibitory Effects of Silvestrol on Nasopharyngeal Carcinoma Cells via RAP1A, HK2, and GADD45A. Frontiers in bioscience (Landmark edition), 2024 (PubMed: 38682208) [IF=3.3]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.