Product: GADD45B Antibody
Catalog: DF2375
Description: Rabbit polyclonal antibody to GADD45B
Application: WB IF/ICC
Cited expt.: WB, IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Dog
Mol.Wt.: 18kDa,22kDa; 18kD(Calculated).
Uniprot: O75293
RRID: AB_2839583

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(100%), Horse(100%), Sheep(100%), Dog(100%)
Clonality:
Polyclonal
Specificity:
GADD45B Antibody detects endogenous levels of total GADD45B.
RRID:
AB_2839583
Cite Format: Affinity Biosciences Cat# DF2375, RRID:AB_2839583.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline, pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

GA45B_HUMAN; GADD45 Beta; Gadd45b; GADD45BETA; Growth arrest and DNA damage inducible 45 beta; Growth arrest and DNA damage inducible beta; Growth arrest and DNA damage-inducible gene GADD45, beta; Growth arrest and DNA damage-inducible protein GADD45 beta; Growth arrest and DNA-damage-inducible protein GADD45 beta; MY118; MYD118; MYD118, mouse, homolog of; Myeloid differentiation primary response gene; Myeloid differentiation primary response protein MyD118; Negative growth regulatory protein MyD118; Negative growth-regulatory protein MyD118;

Immunogens

Immunogen:

A synthesized peptide derived from human GADD45B, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Description:
Involved in the regulation of growth and apoptosis. Mediates activation of stress-responsive MTK1/MEKK4 MAPKKK.
Sequence:
MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Chicken
78
Xenopus
0
Zebrafish
0
Rabbit
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Involved in the regulation of growth and apoptosis. Mediates activation of stress-responsive MTK1/MEKK4 MAPKKK.

Family&Domains:

Belongs to the GADD45 family.

Research Fields

· Cellular Processes > Cell growth and death > Cell cycle.   (View pathway)

· Cellular Processes > Cell growth and death > p53 signaling pathway.   (View pathway)

· Cellular Processes > Cell growth and death > Apoptosis.   (View pathway)

· Cellular Processes > Cell growth and death > Cellular senescence.   (View pathway)

· Environmental Information Processing > Signal transduction > MAPK signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > NF-kappa B signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > FoxO signaling pathway.   (View pathway)

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.

· Human Diseases > Cancers: Specific types > Colorectal cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Pancreatic cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Endometrial cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Glioma.   (View pathway)

· Human Diseases > Cancers: Specific types > Thyroid cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Basal cell carcinoma.   (View pathway)

· Human Diseases > Cancers: Specific types > Melanoma.   (View pathway)

· Human Diseases > Cancers: Specific types > Chronic myeloid leukemia.   (View pathway)

· Human Diseases > Cancers: Specific types > Small cell lung cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Non-small cell lung cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Breast cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Hepatocellular carcinoma.   (View pathway)

· Human Diseases > Cancers: Specific types > Gastric cancer.   (View pathway)

References

1). DNA hypomethylation-mediated upregulation of GADD45B facilitates airway inflammation and epithelial cell senescence in COPD. Journal of advanced research, 2024 (PubMed: 38342401) [IF=11.4]

Application: WB    Species: Human    Sample: HBE cells

Fig. 2. GADD45B aggravated inflammation and cellular senescence in CSE-induced HBE cells. a, b RNA-sequencing of HBE cells with lentivirus infections was performed (n = 3 per group). Volcano plot showed the DEGs in HBE cells infected with Lv-GADD45B compared with Lv-GFP. The results of biological process enrichment analysis of DEGs. c Western blot analysis of Flag in HBE cells infected with Lv-GADD45B (n = 4). d ELISA analysis of IL-6, IL-8 and IL-1β levels in CSE-induced HBE cells with or without Lv-GADD45B infection (n = 7). e–g Western blot analysis of P16 and P21 expressions in HBE cells infected with Lv-GADD45B under CSE treatment (n = 3). h, i Representative images of SA-β-gal staining and percentages of SA-β-gal positive cells for CSE-treated HBE cells overexpressing GADD45B (n = 5, arrowheads indicated the positively stained cells). Scale bar = 50 μm, magnification = x 200. j Western blot analysis for GADD45B expression in HBE cells with siRNA transfection (n = 4). k ELISA analysis of IL-6, IL-8 and IL-1β levels in CSE-induced HBE cells with or without si-GADD45B transfection (n = 4). l–n Western blot analysis of P16 and P21 expressions in HBE cells transfected with si-GADD45B under CSE treatment (n = 3). o, p Representative images of SA-β-gal staining and percentages of SA-β-gal positive cells for CSE-treated HBE cells with GADD45B knockdown (n = 5, arrowheads indicated the positively stained cells). Scale bar = 50 μm, magnification = x 200. Data were expressed as mean ± SD. P-values were calculated using one-way ANOVA followed by Newman–Keuls test or Student’s unpaired t-test. *P < 0.05, **P < 0.01, and ***P < 0.001 represent significant differences. GADD45B, growth arrest and DNA damage-inducible 45 beta; CSE, cigarette smoke extract; HBE, human bronchial epithelial; Lv-GADD45B, lentivirus expressing GADD45B; Lv-GFP, lentivirus with empty vector carrying green fluorescent protein; DEGs, differentially expressed genes; SA-β-gal, senescence-associated β-galactosidase; siRNA, small interfering RNA; NC, negative control. (For interpretation of the references to colour in this figure legend, the reader is referred to the web version of this article.)

2). Insulin-like growth factor binding protein 7 identified in aged dental pulp by single-cell RNA sequencing. Journal of advanced research, 2024 (PubMed: 39674503) [IF=11.4]

Application: IF/ICC    Species: human    Sample:

Fig. 2. Fibroblast identification via scRNA-seq analysis of young and aged dental pulp samples. (A) UMAP of pooled data from scRNA-seq data of dental pulp, highlighting the fibroblast cluster. (B) The actual cell number and (C) ratio of different fibroblast subclusters (FB1 ∼ FB7) in each dental pulp sample. (D) UMAP of subclusters of fibroblasts in eight dental pulp tissues. (E) UMAP plots of seven fibroblast subclusters in each dental pulp sample. (F) Heatmap of the gene expression levels of the top 4 genes in the seven fibroblast subclusters. (G) Violin plots depict the distinct expression of GADD45B in the dental pulp tissue, fibroblasts or the FB1 subcluster of each dental pulp sample. (H) Immunofluorescence of GADD45B (red), FITC (green) and DAPI (blue) in young and aged dental pulp tissue. Scale bars represent 20 µm. (I) Violin plots showing differential expression of GADD45B in each cell type of aged (red) vs. young (green) dental pulp.

3). Bis(2-ethylhexyl)-2,3,4,5-tetrabromophthalate Induces Neurodevelopmental Toxicity through the Gadd45b-MKK7-p21 Pathway: Cell Cycle Arrest and Mitochondrial Dysfunction. Environmental science & technology, 2026 (PubMed: 41826259) [IF=10.8]

4). A functional variant rs912304 for late-onset T1D risk contributes to islet dysfunction by regulating proinflammatory cytokine-responsive gene STXBP6 expression. BMC medicine, 2024 (PubMed: 39227839) [IF=7.0]

Application: WB    Species: Rat    Sample: INS-1E cells

Fig. 5 Gadd45β and Glut1 are two key downstream genes regulated by Stxbp6 in islet β-cell lines. A Volcano plot of recombinant adenovirus overexpressing Stxbp6 gene in INS-1E cells with downstream differential gene expression. Red dots represent genes with rising differential expression, and blue dots represent genes with falling differential expression. DEGs were screened using logFC>0.5, FPKM>1, P-adj

5). Gallic acid alleviates Alzheimer's disease by inhibiting p38/MAPK signaling pathway. Journal of Functional Foods, 2025 [IF=3.8]

Application: WB    Species: Mouse    Sample: brain tissue

Fig. 3. Network pharmacological analysis and the verification of differential expressed genes in the KEGG pathway of transcription analysis. (A) Gadd45b and Gadd45g expression level in GSE29378 database. (B) Venn diagram. (C) GO enrichment analysis. (D) KEGG enrichment analysis. (E) Gene expression in apoptosis, autophagy, p53, and MAPK signaling pathways. (F) The mRNA expression levels of genes in the above four pathways. (G) Protein expression of Gadd45b, Gadd45g, p-p38, p38, and p-p38/p38. Data was presented as mean ± SD, n = 3. #p < 0.05 and ##p < 0.01 compared with the Ctrl group. ⁎p < 0.05 and ⁎⁎p < 0.01 compared with the Mod group.

6). Shikonin reactivates TSGs GADD45B and PPP3CC to block NSCLC cell proliferation and migration through JNK/P38/MAPK signaling pathways. BMC complementary medicine and therapies, 2024 (PubMed: 38167059) [IF=3.3]

Application: WB    Species: Human    Sample: A549 cells

Fig. 5 Shikonin increased tumor suppressor genes PPP3CC and GADD45B in MAPK signaling. A-B. GADD45B and PPP3CC are activated after shikonin treatment in both A549 and H1299 cells by qPCR detection. C-D. The MAPK proteins, GADD45B and PPP3CC are activated after shikonin treatment in both A549 and H1299 cells by western blotting. The blots are cut prior to hybridisation with antibodies during blotting and the cropped plots are used in the figure to improve the clarity of presentation.

7). GADD45B Facilitates Metastasis of Ovarian Cancer Through Epithelial–Mesenchymal Transition. OncoTargets and Therapy, 2021 (PubMed: 33469306) [IF=2.7]

Application: WB    Species: Human    Sample: EOC cell

Figure 3 GADD45B knockdown inhibited the migration of EOC cells. (A, B) Western blot and qRT-PCR detected the expression of GADD45B in the EOC cell lines. (C, D) qRT-PCR and Western blot analysis of the silencing efficiency of GADD45B. (E, G) Wound-healing assays detected the migration ability difference of ES2 and SKOV3 cells between the NC group and the GADD45B siRNA-downregulated groups. (F, H) Histograms show the wound-healing areas of the scratch-wound assays. (I) Transwell assays detected the migration ability of ES2 and SKOV3 cells in the NC group and the GADD45B siRNA-downregulated groups. (J, K) Histograms show the number of migrating cells. Experiments were performed at least in triplicate, and the results are shown as the mean ± s.d. Student’s t-test was used to analyse the data (*p < 0.05; **p < 0.01; ***p < 0.001). Scale bar, 100 μm.

Application: IHC    Species: Human    Sample: tumour tissues

Figure 7 GADD45B is overexpressed in omental metastatic tissues of EOC over matched primary tumour tissues. (A) Representative images of the immunohistochemical analysis of GADD45B in one of the paired tumour tissues. Scale bar, 20 μm. (B) Statistical result of the mean density of GADD45B in 11 pairs of matched EOC tissue samples. Paired Student’s t-test was used to analyse the data (**p < 0.01).

8). Luteolin ameliorates kainic acid-induced seizure by modulating GADD45B and reducing oxidative stress in hippocampal neurons. Neuropeptides, 2025 (PubMed: 40441030) [IF=2.5]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.