Phospho-BAD (Ser155)[Ser118] Antibody

IHC
IF/ICC
pElisa

1/3

AF3471 at 1/100 staining human Breast carcinoma tissue sections by IHC-P.

AF3471 staining Hela cells(4h of LPS treatment) by IF/ICC.

Product:	Phospho-BAD (Ser155)[Ser118] Antibody
Catalog:	AF3471
Description:	Rabbit polyclonal antibody to Phospho-BAD (Ser155)[Ser118]
Application:	WB IHC IF/ICC
Reactivity:	Human, Mouse, Rat
Prediction:	Bovine, Horse, Sheep, Dog
Mol.Wt.:	23kDa; 18kD(Calculated).
Uniprot:	Q92934
RRID:	AB_2834909

View similar products>>

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific.

Size	Price	Inventory
100ul	$280	In stock
200ul	$350	In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Related Downloads

MSDS

Data Sheet

COA

Protocols

WB Handbook

IHC Protocol

IF/ICC Protocol

Product Info

Source:

Rabbit

Application:

WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:

Human,Mouse,Rat

Prediction:

Bovine(100%), Horse(100%), Sheep(100%), Dog(100%)

Clonality:

Polyclonal

Specificity:

Phospho-BAD (Ser155) Antibody detects endogenous levels of BAD only when phosphorylated at Ser118, which site historically referenced as Ser155.

RRID:

AB_2834909
Cite Format: Affinity Biosciences Cat# AF3471, RRID:AB_2834909.

Conjugate:

Unconjugated.

Purification:

The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.

Storage:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

Alias:

Fold/Unfold

AI325008; BAD; BAD_HUMAN; BBC 2; BBC2; BBC6; Bcl 2 Antagonist of Cell Death; Bcl 2 Binding Component 6; BCL X / BCL 2 Binding Protein; BCL X Binding Protein; Bcl XL/Bcl 2 Associated Death Promoter; Bcl-2-binding component 6; Bcl-2-like protein 8; Bcl-XL/Bcl-2-associated death promoter; Bcl2 antagonist of cell death; BCL2 antagonist of cell death protein; BCL2 associated agonist of cell death; Bcl2 Associated Death Promoter; BCL2 binding component 6; BCL2 binding protein; Bcl2 Like 8 Protein; Bcl2-L-8; BCL2L8; Proapoptotic BH3 Only Protein;

Immunogens

Immunogen:

Uniprot:

Q92934(BAD_HUMAN) >>Visit HPA database.

Gene(ID):

BAD(572)

Expression:

Q92934 BAD_HUMAN:

Expressed in a wide variety of tissues.

Description:

The protein encoded by this gene is a member of the BCL-2 family. BCL-2 family members are known to be regulators of programmed cell death. This protein positively regulates cell apoptosis by forming heterodimers with BCL-xL and BCL-2, and reversing their death repressor activity.

Sequence:

Q92934 BAD_HUMAN:
Protein BLAST With
NCBI/
ExPASy/
Uniprot

MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species

Results

Score

Horse

100

Bovine

100

Sheep

100

Dog

100

Pig

Xenopus

Zebrafish

Chicken

Rabbit

Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - Q92934 As Substrate

Q92934

Site	PTM Type	Enzyme	Source
M1	Acetylation		Uniprot
S25	Phosphorylation		Uniprot
S32	Phosphorylation		Uniprot
S34	Phosphorylation		Uniprot
K36	Acetylation		Uniprot
S71	Phosphorylation		Uniprot
S74	Phosphorylation	Q13153 (PAK1)	Uniprot
S75	Phosphorylation	Q9NQU5 (PAK6) , Q15349 (RPS6KA2) , Q9P1W9 (PIM2) , P31749 (AKT1) , P22612 (PRKACG) , P28482 (MAPK1) , P27361 (MAPK3) , O75582 (RPS6KA5) , Q04759 (PRKCQ) , Q13153 (PAK1) , P04049 (RAF1) , P41743 (PRKCI) , Q15418 (RPS6KA1) , P45983 (MAPK8) , Q02156 (PRKCE) , Q86V86 (PIM3) , Q15139 (PRKD1) , P17612 (PRKACA) , P22694 (PRKACB) , P51812 (RPS6KA3) , P11309 (PIM1) , O96013 (PAK4) , P15056 (BRAF) , P10398 (ARAF)	Uniprot
Y76	Phosphorylation		Uniprot
T80	Phosphorylation		Uniprot
S91	Phosphorylation	P06493 (CDK1) , P45983 (MAPK8)	Uniprot
R94	Methylation		Uniprot
R96	Methylation		Uniprot
S97	Phosphorylation		Uniprot
S99	Phosphorylation	Q9Y243 (AKT3) , P51812 (RPS6KA3) , Q04759 (PRKCQ) , Q13153 (PAK1) , P31751 (AKT2) , Q15139 (PRKD1) , P41743 (PRKCI) , P31749 (AKT1) , P15056 (BRAF) , P04049 (RAF1) , Q15418 (RPS6KA1) , Q86V86 (PIM3) , P23443 (RPS6KB1) , P17612 (PRKACA) , Q9P1W9 (PIM2) , Q02156 (PRKCE) , P11309 (PIM1) , P10398 (ARAF) , P22612 (PRKACG) , P22694 (PRKACB)	Uniprot
Y110	Phosphorylation		Uniprot
S118	Phosphorylation	Q15139 (PRKD1) , Q02156 (PRKCE) , P31751 (AKT2) , Q13153 (PAK1) , Q86V86 (PIM3) , P17612 (PRKACA) , Q9P1W9 (PIM2) , P15056 (BRAF) , Q9Y243 (AKT3) , Q15349 (RPS6KA2) , P31749 (AKT1) , Q13976 (PRKG1) , P11309 (PIM1) , P10398 (ARAF) , P04049 (RAF1) , P22612 (PRKACG) , P22694 (PRKACB) , P41743 (PRKCI) , Q15418 (RPS6KA1)	Uniprot
S124	Phosphorylation		Uniprot
S128	Phosphorylation		Uniprot
S134	Phosphorylation	Q13153 (PAK1) , P15056 (BRAF) , Q13555 (CAMK2G)	Uniprot
T137	Phosphorylation		Uniprot
T139	Phosphorylation		Uniprot
S146	Phosphorylation		Uniprot
S153	Phosphorylation	P17612 (PRKACA) , O75582 (RPS6KA5) , Q15418 (RPS6KA1)	Uniprot
R161	Methylation		Uniprot

Research Backgrounds

Q92934_BAD_HUMAN

Function:

Promotes cell death. Successfully competes for the binding to Bcl-X(L), Bcl-2 and Bcl-W, thereby affecting the level of heterodimerization of these proteins with BAX. Can reverse the death repressor activity of Bcl-X(L), but not that of Bcl-2 (By similarity). Appears to act as a link between growth factor receptor signaling and the apoptotic pathways.

PTMs:

Phosphorylated on one or more of Ser-75, Ser-99, Ser-118 and Ser-134 in response to survival stimuli, which blocks its pro-apoptotic activity. Phosphorylation on Ser-99 or Ser-75 promotes heterodimerization with 14-3-3 proteins. This interaction then facilitates the phosphorylation at Ser-118, a site within the BH3 motif, leading to the release of Bcl-X(L) and the promotion of cell survival. Ser-99 is the major site of AKT/PKB phosphorylation, Ser-118 the major site of protein kinase A (CAPK) phosphorylation. Phosphorylation at Ser-99 by PKB/AKT1 is almost completely blocked by the apoptotic C-terminus cleavage product of PKN2 generated by caspases-3 activity during apoptosis.

Methylation at Arg-94 and Arg-96 by PRMT1 inhibits Akt-mediated phosphorylation at Ser-99.

Subcellular Location:

Mitochondrion outer membrane. Cytoplasm.
Note: Colocalizes with HIF3A in the cytoplasm (By similarity). Upon phosphorylation, locates to the cytoplasm.

Tissue Specificity:

Expressed in a wide variety of tissues.

Subunit Structure:

Forms heterodimers with the anti-apoptotic proteins, Bcl-X(L), Bcl-2 and Bcl-W. Also binds protein S100A10 (By similarity). The Ser-75/Ser-99 phosphorylated form binds 14-3-3 proteins (By similarity). Interacts with AKT1 and PIM3. Interacts (via BH3 domain) with NOL3 (via CARD domain); preventing the association of BAD with BCL2 (By similarity). Interacts with HIF3A (via C-terminus domain); the interaction reduces the binding between BAD and BAX (By similarity). Interacts with GIMAP3/IAN4 and GIMAP5/IAN5.

Family&Domains:

Intact BH3 motif is required by BIK, BID, BAK, BAD and BAX for their pro-apoptotic activity and for their interaction with anti-apoptotic members of the Bcl-2 family.

Belongs to the Bcl-2 family.

Research Fields

· Cellular Processes > Transport and catabolism > Autophagy - animal. (View pathway)

· Cellular Processes > Cell growth and death > Apoptosis. (View pathway)

· Cellular Processes > Cellular community - eukaryotes > Focal adhesion. (View pathway)

· Environmental Information Processing > Signal transduction > ErbB signaling pathway. (View pathway)

· Environmental Information Processing > Signal transduction > Ras signaling pathway. (View pathway)

· Environmental Information Processing > Signal transduction > cGMP-PKG signaling pathway. (View pathway)

· Environmental Information Processing > Signal transduction > cAMP signaling pathway. (View pathway)

· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway. (View pathway)

· Human Diseases > Drug resistance: Antineoplastic > EGFR tyrosine kinase inhibitor resistance.

· Human Diseases > Drug resistance: Antineoplastic > Endocrine resistance.

· Human Diseases > Drug resistance: Antineoplastic > Platinum drug resistance.

· Human Diseases > Neurodegenerative diseases > Alzheimer's disease.

· Human Diseases > Neurodegenerative diseases > Amyotrophic lateral sclerosis (ALS).

· Human Diseases > Infectious diseases: Parasitic > Toxoplasmosis.

· Human Diseases > Infectious diseases: Bacterial > Tuberculosis.

· Human Diseases > Infectious diseases: Viral > Hepatitis C.

· Human Diseases > Infectious diseases: Viral > Hepatitis B.

· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.

· Human Diseases > Cancers: Overview > Pathways in cancer. (View pathway)

· Human Diseases > Cancers: Overview > Viral carcinogenesis.

· Human Diseases > Cancers: Specific types > Colorectal cancer. (View pathway)

· Human Diseases > Cancers: Specific types > Renal cell carcinoma. (View pathway)

· Human Diseases > Cancers: Specific types > Pancreatic cancer. (View pathway)

· Human Diseases > Cancers: Specific types > Endometrial cancer. (View pathway)

· Human Diseases > Cancers: Specific types > Prostate cancer. (View pathway)

· Human Diseases > Cancers: Specific types > Melanoma. (View pathway)

· Human Diseases > Cancers: Specific types > Chronic myeloid leukemia. (View pathway)

· Human Diseases > Cancers: Specific types > Acute myeloid leukemia. (View pathway)

· Human Diseases > Cancers: Specific types > Non-small cell lung cancer. (View pathway)

· Human Diseases > Cancers: Specific types > Hepatocellular carcinoma. (View pathway)

· Organismal Systems > Nervous system > Neurotrophin signaling pathway. (View pathway)

· Organismal Systems > Endocrine system > Insulin signaling pathway. (View pathway)

· Organismal Systems > Endocrine system > Thyroid hormone signaling pathway. (View pathway)

Restrictive clause

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.

Phospho-BAD (Ser155)[Ser118] Antibody - #AF3471