VEGFA Antibody | Affinity Biosciences

Product:	VEGFA Antibody
Catalog:	AF5131
Description:	Rabbit polyclonal antibody to VEGFA
Application:	WB IHC IF/ICC
Reactivity:	Human, Mouse, Rat
Prediction:	Pig, Bovine, Horse, Sheep, Rabbit, Dog
Mol.Wt.:	16-20kDa,25-30kDa,40-45kDa; 27kD(Calculated).
Uniprot:	P15692
RRID:	AB_2837617

View similar products>>

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific.

Size	Price	Inventory
100ul	$280	In stock
200ul	$350	In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Related Downloads

MS Report

HPLC Report

MSDS

Data Sheet

COA

Protocols

WB Handbook

IHC Protocol

IF/ICC Protocol

Product Info

Source:

Rabbit

Application:

WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:

Human,Mouse,Rat

Prediction:

Pig(100%), Bovine(89%), Horse(89%), Sheep(90%), Rabbit(100%), Dog(100%)

Clonality:

Polyclonal

Specificity:

VEGFA Antibody detects endogenous levels of total VEGFA.

RRID:

AB_2837617
Cite Format: Affinity Biosciences Cat# AF5131, RRID:AB_2837617.

Conjugate:

Unconjugated.

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Storage:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

Alias:

Fold/Unfold

Folliculostellate cell-derived growth factor; Glioma-derived endothelial cell mitogen; MGC70609; MVCD1; Vascular endothelial growth factor A; vascular endothelial growth factor A121; vascular endothelial growth factor A165; vascular endothelial growth factor; Vascular permeability factor; VEGF A; Vegf; VEGF-A; VEGF120; Vegfa; VEGFA_HUMAN; VPF;

Immunogens

Immunogen:

Uniprot:

P15692(VEGFA_HUMAN) >>Visit HPA database.

Gene(ID):

VEGFA(7422)

Expression:

P15692 VEGFA_HUMAN:

Isoform VEGF189, isoform VEGF165 and isoform VEGF121 are widely expressed. Isoform VEGF206 and isoform VEGF145 are not widely expressed. A higher level expression seen in pituitary tumors as compared to the pituitary gland.

Description:

Sequence:

P15692 VEGFA_HUMAN:
Protein BLAST With
NCBI/
ExPASy/
Uniprot

MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species

Results

Score

Pig

100

Dog

100

Rabbit

100

Sheep

Horse

Bovine

Xenopus

Zebrafish

Chicken

Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P15692 As Substrate

P15692

Site	PTM Type	Enzyme	Source

Research Backgrounds

P15692_VEGFA_HUMAN

Function:

Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth. Binding to NRP1 receptor initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development (By similarity).

Subcellular Location:

Secreted.
Note: VEGF121 is acidic and freely secreted. VEGF165 is more basic, has heparin-binding properties and, although a significant proportion remains cell-associated, most is freely secreted. VEGF189 is very basic, it is cell-associated after secretion and is bound avidly by heparin and the extracellular matrix, although it may be released as a soluble form by heparin, heparinase or plasmin.

Tissue Specificity:

Subunit Structure:

Homodimer; disulfide-linked. Also found as heterodimer with PGF (By similarity). Interacts with NRP1.

Family&Domains:

Belongs to the PDGF/VEGF growth factor family.

Research Fields

· Cellular Processes > Cellular community - eukaryotes > Focal adhesion. (View pathway)

· Environmental Information Processing > Signal transduction > MAPK signaling pathway. (View pathway)

· Environmental Information Processing > Signal transduction > Ras signaling pathway. (View pathway)

· Environmental Information Processing > Signal transduction > Rap1 signaling pathway. (View pathway)

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)

· Environmental Information Processing > Signal transduction > HIF-1 signaling pathway. (View pathway)

· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway. (View pathway)

· Human Diseases > Drug resistance: Antineoplastic > EGFR tyrosine kinase inhibitor resistance.

· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.

· Human Diseases > Cancers: Overview > Pathways in cancer. (View pathway)

· Human Diseases > Cancers: Overview > Proteoglycans in cancer.

· Human Diseases > Cancers: Overview > MicroRNAs in cancer.

· Human Diseases > Cancers: Specific types > Renal cell carcinoma. (View pathway)

· Human Diseases > Cancers: Specific types > Pancreatic cancer. (View pathway)

· Human Diseases > Cancers: Specific types > Bladder cancer. (View pathway)

· Human Diseases > Immune diseases > Rheumatoid arthritis.

· Organismal Systems > Endocrine system > Relaxin signaling pathway.

References

1). Gene-activated engineered exosome directs osteoblastic differentiation of progenitor cells and induces vascularized osteogenesis in situ. Chemical Engineering Journal [IF=15.1]

2). Upregulation of BCL-2 by acridone derivative through gene promoter i-motif for alleviating liver damage of NAFLD/NASH. NUCLEIC ACIDS RESEARCH (PubMed: 32710621) [IF=14.9]

Application: WB Species: human Sample: HepG2

Figure 3. Effect of A22 on gene transcription and translation in HepG2 cells. The mRNA levels of BCL-2 and BAX (A), as well as C-KIT, KRAS, C-MYC and VEGF (B) in HepG2 cells were analyzed by using qRT-PCR after incubation with increasing concentration of A22 for 12 h. (C) Effects of A22 on protein expressions of C-MYC, VEGF, C-KIT and BCL-2 in the presence or absence of increasing concentration of A22 for 24 h, which were quantitatively analyzed

3). SMURF1-mediated ubiquitination of ARHGAP26 promotes ovarian cancer cell invasion and migration. EXPERIMENTAL AND MOLECULAR MEDICINE (PubMed: 31004081) [IF=12.8]

Application: WB Species: human Sample: A2780 and HEY cells

Fig. 3 | ARHGAP26 upregulation inhibited the ovarian cancer cell invasion and migration. A2780 and HEY cells were transduced with recombined ARHGAP26 expression lentivirus or control lentivirus (blank vector). Cell migration and invasion of A2780 (a, b) and HEY cells (c, d) were detected via Transwell analysis, and the expression of GTP-RhoA, total RhoA, β-catenin, VEGF, MMP2, and MMP7 in A2780 and HEY cells was detected via western blotting (e–g).

4). Phenytoin silver: a new nanocompound for promoting dermal wound healing via comprehensive pharmacological action. Theranostics (PubMed: 28255340) [IF=12.4]

Application: WB Species: human Sample:

Figure 6. PnAg regulates gp130/Jak/Stat3 signaling pathway (A) and (B) NIH-3T3 and HaCat Cells were treated with PnAg at different concentrations and cell viability was tested using MTT analysis. (C) Wound healing assay reflected the effect of PnAg on cell migration. (D) Binding mode of PnAg in the active pocket of gp130. (E) and (F) MMPs activity and expression levels of Stat3, VEGF, TGFB-1, and TGFB1 detected using zymographic and Western blot assays. (G) Diagram of the proposed function of PnAg in wound inflammation and re-epithelialization controls.

5). Accelerated Bone Reconstruction by the Yoda1 Bilayer Membrane via Promotion of Osteointegration and Angiogenesis. Advanced Healthcare Materials (PubMed: 36912184) [IF=10.0]

6). Co‐overexpression of VEGF and GDNF in adipose‐derived stem cells optimizes therapeutic effect in neurogenic erectile dysfunction model. CELL PROLIFERATION (PubMed: 31943490) [IF=8.5]

Application: WB Species: rats Sample: Adipose-derived stem cells (ADSCs)

FIGURE 1 Genetically modified ADSCs produced more VEGF and GDNF. A,B, Morphology of ADSCs in passage 0 and passage 3. C,D, Adipose-derived stem cells exhibited pluripotency after induction, as evidenced by the presence of typical phenotype of osteocytes (stained with Alizarin Red S) and the typical phenotype of adipocytes (stained with Oil Red O). E, Flow cytometry showed the ADSCs expressed more stem cell markers (CD90, CD44a and CD29), but less haematopoietic and endothelial markers (CD34, CD11b and CD45). F, Immunofluorescence analysis of the expression of RFP in transfected ADSCs. G,H, Western blot analysis showed markedly increased the levels of VEGF in transfected ADSCs. I, Immunofluorescence analysis of the expression of GFP in transfected ADSCs. J,K, Western blot analysis showed increased the levels of GDNF in transfected ADSCs. L, Immunofluorescence of ADSCs that co-expressed RFP and GFP. M,N, Western blot analysis of ADSCs co-transfected with VEGF and GDNF. All values are represented as the mean ± SD from three independent experiments, each with three replicates. Statistically significant differences from the control group are denoted as follows: ***P < .001, **P < .01 and *P < .05 (independent samples t test)

Application: WB Species: Rat Sample: epididymal adipose tissue

Figure 1 Genetically modified ADSCs produced more VEGF and GDNF. A,B, Morphology of ADSCs in passage 0 and passage 3. C,D, Adipose‐derived stem cells exhibited pluripotency after induction, as evidenced by the presence of typical phenotype of osteocytes (stained with Alizarin Red S) and the typical phenotype of adipocytes (stained with Oil Red O). E, Flow cytometry showed the ADSCs expressed more stem cell markers (CD90, CD44a and CD29), but less haematopoietic and endothelial markers (CD34, CD11b and CD45). F, Immunofluorescence analysis of the expression of RFP in transfected ADSCs. G,H, Western blot analysis showed markedly increased the levels of VEGF in transfected ADSCs. I, Immunofluorescence analysis of the expression of GFP in transfected ADSCs. J,K, Western blot analysis showed increased the levels of GDNF in transfected ADSCs. L, Immunofluorescence of ADSCs that co‐expressed RFP and GFP. M,N, Western blot analysis of ADSCs co‐transfected with VEGF and GDNF. All values are represented as the mean ± SD from three independent experiments, each with three replicates. Statistically significant differences from the control group are denoted as follows: ***P < .001, **P < .01 and *P < .05 (independent samples t test)

Application: IHC Species: Rat Sample: MPG and pen

Figure 3 The expression of VEGF and GDNF in the MPG and penis after transplantation of GM‐ADSCs. A, Immunohistochemical staining of rat MPG tissue cross‐sections from each animal in the respective groups using specific VEGF and GDNF antibodies. Arrows indicate typical immune‐positive cells. B,C, Immunohistochemical score was obtained by analysing the staining intensity and positive rate of VEGF and GDNF. D, After 14 d, transfected ADSCs were visible in the MPG and corpus cavernosa. E, Representative immunofluorescence staining of GDNF (green) in a penile mid‐shaft specimen 2 wk after BCNI and treatment. F, Quantitative analysis of the GDNF‐positive area. G,H, Representative immunofluorescence of VEGF in a penile mid‐shaft specimen, and quantitative analysis of the VEGF immunofluorescence‐positive area. Data are depicted as the mean ± SD from n = 6 animals per group (*P < .05). Immunofluorescence was analysed using one‐way ANOVA followed by the S‐N‐K test. Quantitative analysis of immunohistochemistry was performed using the Kruskal‐Wallis H test

Application: IF/ICC Species: Rat Sample: MPG and pen

7). Carthami flos extract against carbon tetrachloride-induced liver fibrosis via alleviating angiogenesis in mice. PHYTOMEDICINE (PubMed: 36332390) [IF=7.9]

8). Protective effects of dexmedetomidine on the survival of random flaps. BIOMEDICINE & PHARMACOTHERAPY (PubMed: 32446114) [IF=7.5]

Application: IHC Species: Rat Sample: skin flap tissue cells

Fig. 8. (A) Immunohistochemistry was used to detect the expression of vascular endothelial growth factor (VEGF) in the flaps of the three groups of rats; (B) VEGF contents in the flaps of the three groups of rats were expressed by integral absorbance (IA). **P < 0.01, DEX-L group vs. control group; **P < 0.01, DEX-L group vs. DEX-H group. n = 6 per group.

9). Estradiol promotes trophoblast viability and invasion by activating SGK1. Biomedicine & Pharmacotherapy (PubMed: 31203134) [IF=7.5]

10). Activation of aldehyde dehydrogenase-2 improves ischemic random skin flap survival in rats. Frontiers in Immunology (PubMed: 37441072) [IF=7.3]

Application: IHC Species: Mouse Sample:

Figure 8 (A) Immunohistochemistry images of VEGF. All images were obtained at identical magnification, ×200, scale bar = 50 μm. (B) Quantitative analysis of VEGF content (n = 3). Data are represented as mean ± SEM. **P

Restrictive clause

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.

VEGFA Antibody - #AF5131