Product: PKA alpha/beta/gamma CAT Antibody
Catalog: AF7746
Description: Rabbit polyclonal antibody to PKA alpha/beta/gamma CAT
Application: WB IHC
Cited expt.: WB
Reactivity: Human, Mouse, Rat, Monkey
Prediction: Pig, Bovine, Horse, Sheep, Dog, Xenopus
Mol.Wt.: 40kDa; 41kD,40kD(Calculated).
Uniprot: P17612 | P22694 | P22612
RRID: AB_2844110

View similar products>>

   Size Price Inventory
 50ul $250 In stock
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat,Monkey
Prediction:
Pig(100%), Bovine(100%), Horse(100%), Sheep(100%), Dog(100%), Xenopus(100%)
Clonality:
Polyclonal
Specificity:
PKA alpha/beta/gamma CAT Antibody detects endogenous levels of total PKA alpha/beta/gamma CAT.
RRID:
AB_2844110
Cite Format: Affinity Biosciences Cat# AF7746, RRID:AB_2844110.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

cAMP dependent protein kinase alpha catalytic subunit; cAMP dependent protein kinase beta catalytic subunit; cAMP dependent protein kinase catalytic beta subunit isoform 4ab; cAMP dependent protein kinase catalytic subunit alpha; cAMP dependent protein kinase catalytic subunit alpha, isoform 1; cAMP dependent protein kinase catalytic subunit beta; cAMP-dependent protein kinase catalytic subunit alpha; KAPCA_HUMAN; PKA C alpha; PKA C beta; PKA C-alpha; PKACA; PKACB; PPNAD4; PRKACA; PRKACAA; PRKACB; Protein kinase A catalytic subunit alpha; Protein kinase A catalytic subunit; Protein kinase A catalytic subunit beta; Protein kinase, cAMP dependent, catalytic, alpha; Protein kinase, cAMP dependent, catalytic, beta; cAMP-dependent protein kinase catalytic beta subunit isoform 4ab; cAMP-dependent protein kinase catalytic subunit beta; KAPCB_HUMAN; PKA C beta; PKA C-beta; PKACB; Prkacb; protein kinase A catalytic subunit beta; Protein kinase cAMP dependent catalytic beta; cAMP-dependent protein kinase catalytic subunit gamma; KAPCG_HUMAN; KAPG; PKA C gamma; PKA C-gamma; PKACg; PRKACG; Protein kinase cAMP dependent catalytic gamma; Serine (threonine) protein kinase;

Immunogens

Immunogen:

A synthesized peptide derived from human PKA alpha/beta/gamma CAT, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
P17612 KAPCA_HUMAN:

Isoform 1 is ubiquitous. Isoform 2 is sperm-specific and is enriched in pachytene spermatocytes but is not detected in round spermatids.

P22694 KAPCB_HUMAN:

Isoform 1 is most abundant in the brain, with low level expression in kidney. Isoform 2 is predominantly expressed in thymus, spleen and kidney. Isoform 3 and isoform 4 are only expressed in the brain.

P22612 KAPCG_HUMAN:

Testis specific. But important tissues such as brain and ovary have not been analyzed for the content of transcript.

Sequence:
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF

MGNAATAKKGSEVESVKEFLAKAKEDFLKKWENPTQNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDIRVSITEKCAKEFGEF

MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLVMEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFYADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFATTSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Xenopus
100
Zebrafish
0
Chicken
0
Rabbit
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Phosphorylates a large number of substrates in the cytoplasm and the nucleus. Regulates the abundance of compartmentalized pools of its regulatory subunits through phosphorylation of PJA2 which binds and ubiquitinates these subunits, leading to their subsequent proteolysis. Phosphorylates CDC25B, ABL1, NFKB1, CLDN3, PSMC5/RPT6, PJA2, RYR2, RORA and VASP. RORA is activated by phosphorylation. Required for glucose-mediated adipogenic differentiation increase and osteogenic differentiation inhibition from osteoblasts. Involved in the regulation of platelets in response to thrombin and collagen; maintains circulating platelets in a resting state by phosphorylating proteins in numerous platelet inhibitory pathways when in complex with NF-kappa-B (NFKB1 and NFKB2) and I-kappa-B-alpha (NFKBIA), but thrombin and collagen disrupt these complexes and free active PRKACA stimulates platelets and leads to platelet aggregation by phosphorylating VASP. Prevents the antiproliferative and anti-invasive effects of alpha-difluoromethylornithine in breast cancer cells when activated. RYR2 channel activity is potentiated by phosphorylation in presence of luminal Ca(2+), leading to reduced amplitude and increased frequency of store overload-induced Ca(2+) release (SOICR) characterized by an increased rate of Ca(2+) release and propagation velocity of spontaneous Ca(2+) waves, despite reduced wave amplitude and resting cytosolic Ca(2+). PSMC5/RPT6 activation by phosphorylation stimulates proteasome. Negatively regulates tight junctions (TJs) in ovarian cancer cells via CLDN3 phosphorylation. NFKB1 phosphorylation promotes NF-kappa-B p50-p50 DNA binding. Involved in embryonic development by down-regulating the Hedgehog (Hh) signaling pathway that determines embryo pattern formation and morphogenesis. Prevents meiosis resumption in prophase-arrested oocytes via CDC25B inactivation by phosphorylation. May also regulate rapid eye movement (REM) sleep in the pedunculopontine tegmental (PPT). Phosphorylates APOBEC3G and AICDA. Isoform 2 phosphorylates and activates ABL1 in sperm flagellum to promote spermatozoa capacitation. Phosphorylates HSF1; this phosphorylation promotes HSF1 nuclear localization and transcriptional activity upon heat shock.

PTMs:

Asn-3 is partially deaminated to Asp giving rise to 2 major isoelectric variants, called CB and CA respectively.

Autophosphorylated. Phosphorylation is enhanced by vitamin K(2). Phosphorylated on threonine and serine residues. Phosphorylation on Thr-198 is required for full activity.

Phosphorylated at Tyr-331 by activated receptor tyrosine kinases EGFR and PDGFR; this increases catalytic efficiency.

Subcellular Location:

Cytoplasm. Cell membrane. Nucleus. Mitochondrion. Membrane>Lipid-anchor.
Note: Translocates into the nucleus (monomeric catalytic subunit). The inactive holoenzyme is found in the cytoplasm. Distributed throughout the cytoplasm in meiotically incompetent oocytes. Associated to mitochondrion as meiotic competence is acquired. Aggregates around the germinal vesicles (GV) at the immature GV stage oocytes (By similarity). Colocalizes with HSF1 in nuclear stress bodies (nSBs) upon heat shock (PubMed:21085490).

Cell projection>Cilium>Flagellum. Cytoplasmic vesicle>Secretory vesicle>Acrosome.
Note: Expressed in the midpiece region of the sperm flagellum (PubMed:10906071). Colocalizes with MROH2B and TCP11 on the acrosome and tail regions in round spermatids and spermatozoa regardless of the capacitation status of the sperm (By similarity).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Isoform 1 is ubiquitous. Isoform 2 is sperm-specific and is enriched in pachytene spermatocytes but is not detected in round spermatids.

Family&Domains:

Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. cAMP subfamily.

Function:

Mediates cAMP-dependent signaling triggered by receptor binding to GPCRs. PKA activation regulates diverse cellular processes such as cell proliferation, the cell cycle, differentiation and regulation of microtubule dynamics, chromatin condensation and decondensation, nuclear envelope disassembly and reassembly, as well as regulation of intracellular transport mechanisms and ion flux. Regulates the abundance of compartmentalized pools of its regulatory subunits through phosphorylation of PJA2 which binds and ubiquitinates these subunits, leading to their subsequent proteolysis. Phosphorylates GPKOW which regulates its ability to bind RNA.

PTMs:

Asn-3 is partially deaminated to Asp giving rise to 2 major isoelectric variants, called CB and CA respectively.

Subcellular Location:

Cytoplasm. Cell membrane. Membrane>Lipid-anchor. Nucleus.
Note: Translocates into the nucleus (monomeric catalytic subunit). The inactive holoenzyme is found in the cytoplasm.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Isoform 1 is most abundant in the brain, with low level expression in kidney. Isoform 2 is predominantly expressed in thymus, spleen and kidney. Isoform 3 and isoform 4 are only expressed in the brain.

Family&Domains:

Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. cAMP subfamily.

Function:

Phosphorylates a large number of substrates in the cytoplasm and the nucleus.

Tissue Specificity:

Testis specific. But important tissues such as brain and ovary have not been analyzed for the content of transcript.

Family&Domains:

Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. cAMP subfamily.

Research Fields

· Cellular Processes > Cell growth and death > Oocyte meiosis.   (View pathway)

· Cellular Processes > Transport and catabolism > Autophagy - animal.   (View pathway)

· Cellular Processes > Cellular community - eukaryotes > Tight junction.   (View pathway)

· Cellular Processes > Cellular community - eukaryotes > Gap junction.   (View pathway)

· Environmental Information Processing > Signal transduction > MAPK signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Ras signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Calcium signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > cAMP signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Wnt signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Hedgehog signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Apelin signaling pathway.   (View pathway)

· Human Diseases > Drug resistance: Antineoplastic > Endocrine resistance.

· Human Diseases > Neurodegenerative diseases > Parkinson's disease.

· Human Diseases > Neurodegenerative diseases > Prion diseases.

· Human Diseases > Substance dependence > Cocaine addiction.

· Human Diseases > Substance dependence > Amphetamine addiction.

· Human Diseases > Substance dependence > Morphine addiction.

· Human Diseases > Substance dependence > Alcoholism.

· Human Diseases > Infectious diseases: Bacterial > Vibrio cholerae infection.

· Human Diseases > Infectious diseases: Parasitic > Amoebiasis.

· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.

· Human Diseases > Infectious diseases: Viral > HTLV-I infection.

· Human Diseases > Infectious diseases: Viral > Epstein-Barr virus infection.

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Overview > Viral carcinogenesis.

· Human Diseases > Cancers: Overview > Proteoglycans in cancer.

· Human Diseases > Cardiovascular diseases > Dilated cardiomyopathy (DCM).

· Organismal Systems > Immune system > Chemokine signaling pathway.   (View pathway)

· Organismal Systems > Aging > Longevity regulating pathway.   (View pathway)

· Organismal Systems > Aging > Longevity regulating pathway - multiple species.   (View pathway)

· Organismal Systems > Circulatory system > Adrenergic signaling in cardiomyocytes.   (View pathway)

· Organismal Systems > Circulatory system > Vascular smooth muscle contraction.   (View pathway)

· Organismal Systems > Immune system > Platelet activation.   (View pathway)

· Organismal Systems > Environmental adaptation > Circadian entrainment.

· Organismal Systems > Nervous system > Long-term potentiation.

· Organismal Systems > Nervous system > Retrograde endocannabinoid signaling.   (View pathway)

· Organismal Systems > Nervous system > Glutamatergic synapse.

· Organismal Systems > Nervous system > Cholinergic synapse.

· Organismal Systems > Nervous system > Serotonergic synapse.

· Organismal Systems > Nervous system > GABAergic synapse.

· Organismal Systems > Nervous system > Dopaminergic synapse.

· Organismal Systems > Sensory system > Olfactory transduction.

· Organismal Systems > Sensory system > Taste transduction.

· Organismal Systems > Sensory system > Inflammatory mediator regulation of TRP channels.   (View pathway)

· Organismal Systems > Endocrine system > Insulin signaling pathway.   (View pathway)

· Organismal Systems > Endocrine system > Insulin secretion.   (View pathway)

· Organismal Systems > Endocrine system > Ovarian steroidogenesis.

· Organismal Systems > Endocrine system > Progesterone-mediated oocyte maturation.

· Organismal Systems > Endocrine system > Estrogen signaling pathway.   (View pathway)

· Organismal Systems > Endocrine system > Melanogenesis.

· Organismal Systems > Endocrine system > Thyroid hormone synthesis.

· Organismal Systems > Endocrine system > Thyroid hormone signaling pathway.   (View pathway)

· Organismal Systems > Endocrine system > Oxytocin signaling pathway.

· Organismal Systems > Endocrine system > Glucagon signaling pathway.

· Organismal Systems > Endocrine system > Regulation of lipolysis in adipocytes.

· Organismal Systems > Endocrine system > Renin secretion.

· Organismal Systems > Endocrine system > Aldosterone synthesis and secretion.

· Organismal Systems > Endocrine system > Relaxin signaling pathway.

· Organismal Systems > Excretory system > Endocrine and other factor-regulated calcium reabsorption.

· Organismal Systems > Excretory system > Vasopressin-regulated water reabsorption.

· Organismal Systems > Digestive system > Salivary secretion.

· Organismal Systems > Digestive system > Gastric acid secretion.

References

1). Beta-Cell Tipe1 Orchestrates Insulin Secretion and Cell Proliferation by Promoting Gαs/cAMP Signaling via USP5. Advanced science (Weinheim, Baden-Wurttemberg, Germany), 2024 (PubMed: 38417114) [IF=15.1]

Application: WB    Species: Mouse    Sample: MIN6 cells

Figure 3 Tipe1 maintains β cell function via Gαs/cAMP pathway. A) Tipe1 interaction proteins in MIN6 cells and differentially expressed genes in human IGT and T2D (Hba1c > 6%, 0.2 < logFC

2). CGRP-releasing PLGA/nHA/GO composite microspheres enhance distraction osteogenesis via activation of the cAMP/PKA/CREB pathway. Materials today. Bio, 2025 (PubMed: 40893374) [IF=8.7]

Application: WB    Species: Rat    Sample:

Fig. 5. Molecular Mechanism Analysis (A) Intracellular cAMP concentration measured by ELISA after 30 min of treatment, normalized to total protein content (n = 3). (B–D) Western blot analysis and quantitative assessment of PKA and CREB phosphorylation levels. (B) Representative Western blot images showing p-PKA (Thr197), total PKA, p-CREB (Ser133), total CREB, and GAPDH expression. (C) Quantitative analysis of p-PKA/total PKA ratio. (D) Quantitative analysis of p-CREB/total CREB ratio. (E) qRT-PCR analysis of osteogenic-related gene mRNA expression after 7 days of osteogenic induction. Relative expression levels of Runx2, Osx, OPN (Spp1), OCN (Bglap), and CyclinD1 normalized to Gapdh internal control using 2^-ΔΔCt^ method (n = 3). (F) Representative Western blot images showing expression of osteogenic proteins Runx2, Osx, OPN, OCN, CyclinD1, and GAPDH loading control. (G) Quantitative analysis of protein expression levels normalized to GAPDH (n = 3).

3). Melatonin Promotes the Synthesis and Secretion of Growth Hormone in the Adenohypophysis by Activating the cAMP/FOXO1 Pathway. Journal of pineal research, 2026 (PubMed: 41870323) [IF=8.3]

4). β-asarone improves cognitive impairment and alleviates autophagy in mice with vascular dementia via the cAMP/PKA/CREB pathway. Phytomedicine : international journal of phytotherapy and phytopharmacology, 2024 (PubMed: 38039902) [IF=6.7]

5). Noncoding SNP at rs1663689 represses ADGRG6 via interchromosomal interaction and reduces lung cancer progression. EMBO reports, 2023 (PubMed: 37154297) [IF=6.5]

6). Protective effects of 4-geranyloxy-2,6-dihydroxybenzophenonel on DSS-induced ulcerative colitis in mice via regulation of cAMP/PKA/CREB and NF-κB signaling pathways. Phytotherapy Research, 2023 (PubMed: 36428266) [IF=6.1]

7). Knockout of Stearoyl-CoA Desaturase 1 Decreased Milk Fat and Unsaturated Fatty Acid Contents of the Goat Model Generated by CRISPR/Cas9. Journal of agricultural and food chemistry, 2022 (PubMed: 35343224) [IF=5.7]

8). GnRH-driven FTO-mediated RNA m6A modification promotes gonadotropin synthesis and secretion. BMC biology, 2024 (PubMed: 38702712) [IF=5.4]

Application: WB    Species: Rat    Sample:

Fig. 3 FOXP2 regulates gonadotropin synthesis and secretion via activating the cAMP/PKA signaling pathway. A WB analysis cAMP, PKA, and p-PKA transfected with vector (Vector group) or FOXP2 overexpression plasmid (FOXP2 group) in LβT2 cells and primary rat adenohypophysis cells. B Detection of intracellular cAMP levels transfected with vector (Vector group) or FOXP2 overexpression plasmid (FOXP2 group) in LβT2 cells (left) and primary rat adenohypophysis cells (right). C Statistical analysis of cAMP protein expression changes in LβT2 cells (left, n = 2) and primary rat adenohypophysis cells (right, n = 2). D Statistical analysis of p-PKA protein expression changes in LβT2 cells (left, n = 2) and primary rat adenohypophysis cells (right, n = 2). E, F FOXP2 overexpression plasmid or vector was transfected into LβT2 cells with or without the indicated compounds (DDA, 10 μM; H89, 10 μM). The expression of Fshb and Lhb mRNA was assayed by RT-qPCR (E, n = 3). The secretion of FSH and LH was assayed by ELISA (F, n = 5). G, H FOXP2 siRNA or siNC were transfected into LβT2 cells with or without the indicated compounds (8-Bromo-cAMP, 500 μM; H89, 10 μM). The expression of Fshb and Lhb mRNA was assayed by RT-qPCR (G, n = 3). The secretion of FSH and LH was assayed by ELISA (H, n = 5). *, P 

9). Study of the mechanism by which Xiaoyan decoction combined with E7449 regulates tumorigenesis in lung adenocarcinoma. Journal of cellular and molecular medicine, 2024 (PubMed: 38898581) [IF=5.3]

Application: WB    Species: Mouse    Sample:

FIGURE 6 Western blot assays were adopted to compare the levels of PKA, Duplin, Stbm, β-catenin, C-myc, Bcl-2 and caspase-3 among the four groups.

10). Combination of pseudoephedrine and emodin ameliorates LPS-induced acute lung injury by regulating macrophage M1/M2 polarization through the VIP/cAMP/PKA pathway. Chinese Medicine, 2022 (PubMed: 35123524) [IF=5.3]

Application: WB    Species: Rat    Sample: lung tissues 

Fig. 6 Pseudoephedrine + emodin up-regulated VIP/CAMP/PKA pathways and Inhibited NF-κB in LPS-induced acute lung injury in rats. A, D VIP, cAMP mRNA expression was determined using Real-time PCR analysis. B, C, E–H Western blot analysis was performed to detect VIP, cAMP, p-PKA, p-IκBα and p-P65 protein expression. All data are expressed as mean ± S.D. (n = 3). ##p < 0.01, ###p < 0.001 vs. control group. *p < 0.05, **p < 0.01, ***p < 0.001 vs. LPS alone group. +p < 0.05, ++p < 0.01, +++p < 0.001 vs. combined treatment group (5 + 20 mg/kg)

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.